SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_073344716.1.12560 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_073344716.1.12560
Domain Number 1 Region: 197-589
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000262
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 
Domain Number 2 Region: 80-195
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000366
Family PKD domain 0.0033
Further Details:      
 
Domain Number 3 Region: 27-109
Classification Level Classification E-value
Superfamily PKD domain 0.0000942
Family PKD domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_073344716.1.12560
Sequence length 619
Comment protease [Bacteroides sp. Marseille-P3132]; AA=GCF_900130125.1; RF=na; TAX=1871006; STAX=1871006; NAME=Bacteroides sp. Marseille-P3132; strain=Marseille-P3132; AL=Contig; RT=Major
Sequence
MKRIIYLLVAAIGLLIGCTPDEETWVQAGFTTDKESYEIGDLITLTNTSTAENAQIAVCK
WEFMGKVSYELTAPEPFSVEEGGDYLFRLTVTSDHGAMKSIFEKTIKIIDDGVRPTADFN
WLPERIVAGEEVTFTDQSKAAEGCEIVKREWTFGAILSTEENPKITFGSHGKINVSLTVT
DNKKRKDTKTVTMDIAKGAGSLGVLWSHSYDEQGVVYGTSPATSADGQYVYVSSSNYNLV
CFTKLGERTWGFDCGQNNEPNRGSDYQHPTPTVDSDGTVYVAVGDNTTKAGADASKSASL
YAIKGGADGGTQMWFTAIGAKSSMRPFGAPVVTDQYVMLLTNSAPSTDGKHFRIYDKVSG
VLKYSEKTSSGSYGGCVGLKDGRILVNTGQSSGRSYGTHIFFPEGNSWSKSTNEQNYAPN
DQPNGSQIATGADGKAYILCLNLGARISTNETKALVYCYDTKKTTKGQVSTPEWYTAVKG
ENKQTGYGLVVDGNGVVYVATDKYITAISSTGSVLWATEVAGTAYGVPAIDNEGYIYYND
AEKGSLVKLEPATGKAIASLQLGTELKSSPTISADGTIYVTGMLEGKPTLFAVEGAATGY
AANAWSQMGGNPGKSGYMY
Download sequence
Identical sequences WP_073344716.1.12560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]