SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_073400072.1.48434 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_073400072.1.48434
Domain Number 1 Region: 710-1137
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.2e-32
Family alpha-mannosidase, C-terminal domain 0.0093
Further Details:      
 
Domain Number 2 Region: 289-455
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000122
Family alpha-mannosidase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_073400072.1.48434
Sequence length 1169
Comment hypothetical protein [Mucilaginibacter sp. OK098]; AA=GCF_900142915.1; RF=na; TAX=1855297; STAX=1855297; NAME=Mucilaginibacter sp. OK098; strain=OK098; AL=Scaffold; RT=Major
Sequence
MKTLNITLSISLVFVLIGFSCLAQNTTFKISKDIRASEITSSASSSFGPDQSVNHLTDGS
GIHNNLHDNNGSALTMWHTTENPVASIPAKGLPLCKAWVRFDFSTQKSFNKIWIWNHNQE
NLTSRGFRLIKVYGTTNEIDWFELTTLELPDAKNLNGKASEIVVNEKKALKSVIIAAESN
WGGNVYGLSGVKFIAELEVNESALPFPNDFECAPTSIYRYCKDGKPGREVVLTFKGANLY
QPSEIEVTADSRTITTSVPFRKDGLETATIILPSGVGVEKEIQIFVSLKAGSKIIRKSFV
LPKQRQWTVYIYPHAHVDIGYTNTQANVEIIHKRNLINGMKLAKETANYPEGARYIWNPE
VMWPVERYLKNATPTEREELLDAIRKGYIHLDAGYINDNTSVTADEEFPGFFGEAKRLEK
LTGVPVSTIDQTDVPGMSWGIVPMAAQFGIKYVFAPFNGSDRTGLADKFNFKPFWWIGQD
GVSKVLFLQPGDYTPGAREKGFKYWPLMAGQKDPNKLLQIVKTDHPRENFIDGYLWEKLK
QLEGNSSYPYDLFPMTWAMADNTPIDADLPDAVKSWNEEYAFPHLVIASSTDIMSAFEKK
YGDIIPSFRGDFTEYWTDGLGAAAKETAMNRKSKERLIQTDVLWSMLHPREKAPRPEMNE
AWRNVLMGSEHTWCYMNPYQADMQDEIWGVKQNFFNTAEKSSIQLLANALSAVSTDKSNI
FCVFNTLSWARNGLITISNDQSEGVLSVRDENNKLVESQRLSTGELVFLASDVPALGTKN
YTLSTESGGKSGVKMAKGNILDNGLVKILIDPVTGDITSLKDKTGVEFVNPGDACNMNSF
RYLLGSGKPASSGPQYAANVTTPFSTTLQKPVHATGPTEVQTLIKENGPLLAAIEVTSKA
DGCNKLTREVRVIAGMPEIEINNLVDKIAITEKEGIHFGFSFNIPNGRTRIDVPWSVVEI
DADQLPAANRNWICFQRWLDISNEGKGITWCSLDAPTFESGNITANIIGGAFHSPEWIQH
LPLSSTIYSWALNNHWHTNFPLSQEGKLSFRYRILPHQYAYDAVKANRFGLEQSQPLIAT
PVKEKISLNTLVKIDNLNVFISIIKTSEDGKSMIIRLRSLSDKPEKVNLSFPSFKPQSIR
TCVADETPGEEAGNSINMLPHGITSLIIE
Download sequence
Identical sequences A0A1M7FH75
WP_073400072.1.48434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]