SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_073865315.1.37918 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_073865315.1.37918
Domain Number 1 Region: 120-330
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.84e-29
Family alpha-mannosidase 0.012
Further Details:      
 
Domain Number 2 Region: 561-999
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.73e-20
Family alpha-mannosidase, C-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_073865315.1.37918
Sequence length 1029
Comment alpha-mannosidase [Streptomyces sp. CB01249]; AA=GCF_001905735.1; RF=na; TAX=1703929; STAX=1703929; NAME=Streptomyces sp. CB01249; strain=CB01249; AL=Scaffold; RT=Major
Sequence
MPRPDLSRPSWWDSDIARDILRDRGVSATGVLGGHPVRLSCEPLLRHDGDGGLLQSVRVQ
AGRPLTRAVVTTLSGASVRSELIPGPAGETRMLVPEVDAPLPVLVELPDLAPGEQVEVLL
TPQRHWTLHLVQHAHLDIGYTDPQGTVLAEGRKYLDSLLELCRTTDDRPDASKFRWAVEG
FFSFENWSANRPPEQVAQFLERVRQGRIELTAMPFNLHTETCSTDELHELLRPVRELRAR
HGIDVTTAMQTDVPGQVVGLPDVLADSGIRYLSVAHNWAGRAVPHHTGGGALPRLFRWRA
PGGRSVLVWRTDTPHGLAYMEGSILGFDESYDRVDDLLPHYLSALATRQYPHEGRGIPGF
PVLDEEFKGDPYPWDVLHLRVLGKFADNGPPRRVIADTVRRWNEEWAFPALRTSRNEDFF
LDAEARYGDRLETLEGDWSDWWVDGVGAGAVPLAATRDGQAALADAQTVAGHAEILGAAG
SGTTASAPEVYRAASLFNEHTWGGGDPWTHGDHGHASGERQWHWKYAQALRAHDDAKTLL
DGASAALGGRLSPREGTLAGFYVTNTCSWPRSETVRLFLPESTVALEDPVRVLDARDGSV
LEHTEEAQSNELHRAAGRFLLFRLTEVPAHGAVRVDVVPGQEPPAAPESRSEEPAVLENE
FLRVRVDLRSAWIGSVVDKRTGRELVRQDATVGLNAYVYDEYATAGGFNHQSSKTTANGS
MHLLASRTAAPPAALVHRFRDATGETLVYECAPAGTERLRVRVHLPHGQARIDLENRIAK
PATLTKESAFFAFPFAMRRPDVRMEATGGMTGSGLPVVPGSAQHMRAVRRWVSFAEDEVV
AAVATQDAPLVQVGGIAVPYAPYPQSLAQDEPGTLFSWVHNNIWDTNFPSEQAFDHVFRY
SVSFGQTPHTSGPVLGMHTAAVGSRPLLAVRALGEKSPAPDASYGLLSVSDRRVRVVGLT
VPTPGQVLVRLQSFAEEPVACRITPGFSVTEARTADYLGASGDLLTPDEDGATTVDMPVL
GTRAVLLRL
Download sequence
Identical sequences A0A1Q5DB23
WP_073865315.1.37918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]