SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_074239076.1.80811 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_074239076.1.80811
Domain Number 1 Region: 529-781,828-926
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.39e-31
Family alpha-mannosidase, C-terminal domain 0.0065
Further Details:      
 
Domain Number 2 Region: 111-304
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000815
Family alpha-mannosidase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_074239076.1.80811
Sequence length 948
Comment glycoside hydrolase [Chitinophaga niabensis]; AA=GCF_900129465.1; RF=representative genome; TAX=536979; STAX=536979; NAME=Chitinophaga niabensis; strain=DSM 24787; AL=Scaffold; RT=Major
Sequence
MSKKSLLLLAGISCFTAVTAQDTFTGIELQPTVAYLKKDGKEARMVRLLFHGGNSYAKAT
VRMEFNGRLDSVLVPASEKGISLYELPLPGDAVGRETQLSVQLTSGGRVYNSRCMVAPTQ
KWKVYLLPHSHVDIGYTNVQAKVMKIHLDNIDEAIKIAKKTEQYPEGARFKWNTEAFWVV
DHYLAGADEAKKKAFWEAVKKGWINIDGAYANINTSITDSRQLMQMFHTAVKTAKEHGVE
IHTMFQGDVPGASWGLSSQADITGIKYFWGAPNAGDRIGNSYKWRDRPFYWQSPGGQKLL
YWQSSPYSIGYSLKGNKIPNFFTVEDPLPFYTGKPSENFLNPFLFNYLGELDQKLFPYNM
TILTWAMSDNAPIDPELPDAVKEWNERYASPQLVITSVKDFFHDFEAAYGAKVPVVSGDY
TEYWTDGIASAARETGINRNNSDRLLQAEAIWALRNKKAFPARDFDTAWNNVLMFNEHTW
GAHNSVSNPADPKAIAQWSYKQAFALTGLAQSKDLLAKAAADVTAASGVDVYNTLGQQRT
DVVLIPAEQSIAGDLVKDASGRSVPSQRLSTGELAVLVKQIPAFSKQRFTIHNGKAYAGE
RATVTTTTLQNKFYTIKLDEKTGHIISLEKAGRNLADSGGLNQYTYLPDAAKEKVRFAGP
AKVTIKEKGPLVVSLEVVSDAPGANSLKREVRLTAGVDRVEIINTLDKKAVPEKEGVHFA
FPFKVPGAQVRYSIPWGSVAAEEDQLQHANRNWYSVQRWVDVSNKDFGVTWSSLDAPLFE
IGTQTSAGLLGGLTRSPKWISYMEQSPAIYSWVMNNLWHTNFRRDQEGVTVFRYALQVHD
AYDVVAANQRGFSNHRSLVATPAAGPATESLFFSIDNKAVYVESIKPAADGKGVVVQLVN
TQEQPAVVTFKGKVNVWQSNMLEEYKNKLEDRVELPGKGVIMVRVETK
Download sequence
Identical sequences A0A1N6F2H5
WP_074239076.1.80811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]