SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_074910970.1.4322 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_074910970.1.4322
Domain Number 1 Region: 80-195
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000536
Family PKD domain 0.003
Further Details:      
 
Domain Number 2 Region: 197-593
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000298
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 
Domain Number 3 Region: 27-109
Classification Level Classification E-value
Superfamily PKD domain 0.0000765
Family PKD domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_074910970.1.4322
Sequence length 619
Comment protease [Bacteroides xylanisolvens]; AA=GCF_900114865.1; RF=na; TAX=371601; STAX=371601; NAME=Bacteroides xylanisolvens; strain=NLAE-zl-C202; AL=Scaffold; RT=Major
Sequence
MKRIIYLLVAAIGLLVGCTPDEETWVQAGFTTDKESYEIGDLITLTNTSTAENAQIAVCK
WEFMGKVSYELTAPEPFSVEEGGDYLFRLTVTSDRGAMKSVFEKTIKIIDDGVRPTADFS
WLPERIVAGEEVAFTDQSKAAEGSEIVKREWTFGAILSTEENPKITFGSHGKINVSLTVT
DNKKRKDTKTVTMDIAKGAGSLGVLWSHSYDEQGVVYGTSPATSTDGQYIYVSSSNYNLV
CFTKLGERTWGFDCGQNNEPNRGSDYQHPTPTVDSDGTVYVAVGDNTTKAGADASKSASL
YAVKGGADGGTQMWFTAIGAKSSMRPFGAPAVTDQYVMILTNSAPSTDGKHFRIYDKVSG
VLKYSEKTSSGSYGGCVGLKDGRILVNTGQSSGRSYGTHIFFPEGNSWSKSTNEQNYAPN
DQPNGSQIAIGADGKAYILCLNLGARISTNETKALVYCYDAKKTTKGQVSTPEWYTAVKG
ENKQTGYGLVVDGNGVVYVATDKYITAISSTGSVLWATEVAGTAYGVPAIDNEGYIYYND
AEKGSLVKLEPATGKAIASLQLGTELKSSPTISADGTIYVTGMLEGKPTLFAVEGAATGY
AANAWSQMGGNPGKSGYMY
Download sequence
Identical sequences A0A1I4ZSG9
WP_074910970.1.4322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]