SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_076699734.1.3967 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_076699734.1.3967
Domain Number 1 Region: 730-1185
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.57e-41
Family alpha-mannosidase, C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 317-519
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.67e-26
Family alpha-mannosidase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_076699734.1.3967
Sequence length 1186
Comment hypothetical protein [Seonamhaeicola sp. S2-3]; AA=GCF_001971785.1; RF=na; TAX=1936081; STAX=1936081; NAME=Seonamhaeicola sp. S2-3; strain=S2-3; AL=Complete Genome; RT=Major
Sequence
MRLIIIICLSLTISANANHLDKNPSLYFHEGNSNSHIQELNTNYKLYNVCKNDFEGYTKP
LSGREFGNYGCIREGLYASLFTRSNSNDDPIAFLTGKVPVDYNEDTVTFFMISNLSLKHR
DHFNIHVNGNFLLTFKPNKEGVLEITDPVFKSDVEFILVKRDGNGDGYGAMRLTVPTSFL
KKGKSAKVTIEGHRKNDNAWAMIFMANDAVEYTTKLALNGVSFDLKEKNGILYVDAPTHF
AGKKVFVTSDGVKSSTKTFEIVGELAKASFKIQAPKTSFSISYGNETMTILFENNDGTIT
TTDIQGPYLLHHNCKYKDEWRATLTKLYRPEFYDTYDAFFDKTYENGQVSIMNSSHQDIA
WVNRPEVCIILRDTMLLKPVIRDAFIRDDYGFDIEDGLMLREYLNRNPDSKEKITTLLNK
QLISVGASYNCPYEDMYDAEDQVRQLYLGKKWVKKTFGGYDSKVYWNVDVPGKTLQLPQI
LKKAGVDYMVISRHARGMFHWASPDGSSVFAYSPGHYGVDETMLRRGEMKDKIKYGAEQI
MFWEKNFDTDKIQTPLLSSQDMLPAIDYSDYIEAWNSFESIKTEDGETQNIHLPPMELMT
VDEYMPLAEKHATKVDTIIGERPNVWVYIHGAGHHEALTASREGSKLLPGAEKFLAIANK
LDPAKIPYPFEEFDEAWQAKIYPDHGWGGHDGDVTDNLFKANLVKSRVMGQKLLDRGINF
ISSKIKKNDKLGMPLVLFNSLSWDRIDPVTTKVQFSKGSFFNVSVVTSKKEQIRSQISNP
EYYSDGSLKSAVITFIANVPSIGYATYYLQNKANSKSNTKTNGNTNQYENPYYKIDFEDG
GIAQVYDKVLKKNLFKNDTFKVGEIFTMESVGTGAGEFSDVQQPTMKDFDHVSKHNPKWE
IIEHGSVYTKYMLEQPILHTIVRQDITVYHDLKRIYFNNSLRNWDGKLYREFRTAFPINM
DNPEVAYEVPFGNVKVGKDEIETAGDFYTPLCKNVRPRGIIDWISATDDDMTVTLSSSVS
TADWKDPTEQTDTTILQNLLLASRRSCHWEGNEYSQGGDHFYHNVLTSTKKGSVEGKKIA
KQENEPIQVVVNPITTAKPYLPQNLSFFSIDADNIIITTIKKAEDSVDFITRMYNVEGST
ETVNLSSYFDIKSYHHTNIIEENPVPVSPQLEIGKYAIETYSLKVD
Download sequence
Identical sequences A0A1U7DSP8
WP_076699734.1.3967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]