SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_078674942.1.24974 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_078674942.1.24974
Domain Number 1 Region: 656-935,975-1060
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.51e-31
Family alpha-mannosidase, C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 272-555
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000612
Family 4-alpha-glucanotransferase, N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_078674942.1.24974
Sequence length 1096
Comment glycoside hydrolase [Elizabethkingia anophelis]; AA=GCF_002023425.1; RF=na; TAX=1117645; STAX=1117645; NAME=Elizabethkingia anophelis; strain=CSID_3000516810; AL=Contig; RT=Major
Sequence
MTGNFIHAQKKVPYFGNINVINGYENEIIGENIDYFSAFPDHATRALLTRTTDGEKTIEW
ETAKVPQKNSGPYVYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQRPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPINKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDANVTPFILKDGKRLITLTTLHFGPEEKIIAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNIQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKDGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGFKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDDWNKKYTSPKIVLST
NEKMFEVFEKKYGDKLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
RLYNSQTFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLEGNSLANQLEK
DLLQPLTNPGSKKIEVFNTSSWTRSGVVTITATAEGNSVQDARGNKIPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLATTPFIVTNNSISNGKITLTWDNKTGSITHFTDNGTTNYA
GSYNNQGLNSYWYVPGSDPKEAKSNTEVQTKILENGPVMVKVLLTAEAPGANKLERIITL
YKDSDEALLENIVDKKPIRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDIGTTGTTNWFSYA
MNNYWHTNYKADQDGPVHYRYALRPHDSFNSVENEKYAAAFTQPLIAIPVNEKADIKGSL
FHMKNDKIVVTSITPQDDQSFIIRLYNPDEKEQTTTFTWERLKPSKLIYNKTAKEISIND
SISLNSMDVIEIKVIP
Download sequence
Identical sequences WP_078674942.1.24974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]