SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_078701708.1.38141 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_078701708.1.38141
Domain Number 1 Region: 656-935,975-1060
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.55e-28
Family alpha-mannosidase, C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 272-557
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000035
Family 4-alpha-glucanotransferase, N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_078701708.1.38141
Sequence length 1096
Comment glycoside hydrolase [Elizabethkingia genomosp. 3]; AA=GCF_002023545.1; RF=na; TAX=1756149; STAX=1756149; NAME=Elizabethkingia genomosp. 3; strain=CSID_3000516589; AL=Contig; RT=Major
Sequence
MTGNFIYAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRTTDGAKTIEW
ETAKVPQKNSGPYVYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQHPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPINKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDASATPFILKDGKRLINLTTLHFGPEEKITAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNVQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALRMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKDGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWLSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGDQLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
RLYNSQHFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLDGNSLANQLEK
DLLQPLTNPGSKKIEVFNTSSWTRNGVATIPATAEGNSVQDAAGNKIPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLATTPFVVTNNSVSNGKITLTWDNKTGSITHFTDNGTTNYA
GSFKNQGLNSYWYVPGSDPNDAKSNTEVQAKILENGPVMVKVLLTADAPGANKLERIITL
YKDSDEALLDNIIDKKPVRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDKGTLGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDTFNSVENEKYAAAFTQPLIAIPVIEKADIKGSL
FHMKNDKIVVTSITPQDDQSFTIRLYNPDEKEQTTTFTWERLKPSKLIYNKTGKEIFIND
SVSLNSMDVIEIKVIP
Download sequence
Identical sequences A0A2H2XSR6
WP_078701708.1.38141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]