SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_078772363.1.10389 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_078772363.1.10389
Domain Number 1 Region: 656-935,975-1060
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.23e-30
Family alpha-mannosidase, C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 272-558
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000005
Family 4-alpha-glucanotransferase, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_078772363.1.10389
Sequence length 1096
Comment MULTISPECIES: glycoside hydrolase [Elizabethkingia]; AA=GCF_002023715.1; RF=na; TAX=1867263; STAX=1867263; NAME=Elizabethkingia sp. G4070; strain=G4070; AL=Contig; RT=Major
Sequence
MAGNFIYAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRTTDGVKTIEW
ETAKVPQKNSGPYVYFNWLVSHSSGSSGGIRNFDLYINDQKALTLSTYPANQHPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPVNKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDANATPFILKDGKRLITLTTLHFGSEEKITAKIDNKDSFTFTMPDGIKTFDIPVTL
PQAGGNVQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIDETRNLPEEARFKWNVEALWDVENFIQKATPEDKKAFVKAVKEGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQRKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NENMFEVFEKKYGDHLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
RLYNSQSFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLEGNSIANQLEK
DLLQPLTNPGSKKIEVFNTSSWSRSGVVTIPATAEGNSVQDAAGNKMPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLGATPFVVTNNSVSNGKITLTWDNNTGSITNFTDNGTTNYA
GSFNNQGLNSYWYVPGSDPNEAKSNTEVQTKILENGPVTVKILLTADAPGANKLERIITL
YKDSDEALLENIVDKKPVRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDKGTPGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDTFNSVENEKYAAAFTQPLIAIPVNEKAAIKGSL
FNMKNDKIVVTSITPQDDQSFMIRLYNPDEKEQTTTFTWERLKPSKLIYNKTGKEISIND
LVSLNSMDVIEIKAIP
Download sequence
Identical sequences A0A1T3MGG2
WP_078772363.1.10389 WP_078772363.1.49850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]