SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_078781772.1.43920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_078781772.1.43920
Domain Number 1 Region: 657-935,975-1060
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.05e-26
Family alpha-mannosidase, C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 272-557
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000395
Family 4-alpha-glucanotransferase, N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_078781772.1.43920
Sequence length 1096
Comment glycoside hydrolase [Elizabethkingia miricola]; AA=GCF_002023515.1; RF=na; TAX=172045; STAX=172045; NAME=Elizabethkingia miricola; strain=CSID_3000516464; AL=Contig; RT=Major
Sequence
MTGNFIYAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRTTDGAKIIEW
ETAKVPQKSSGTYVYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQHPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPINKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDASATPFILKDGKRLINLTTLHFGPEEKITAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNVQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKEGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NENMFEVFEKKYGDQLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
RLYNTQRFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLDGNSLTNQLEK
DLLQPLTNPGSKKIEVFNTSSWIRSGVITIPAAAEGNSVQDAAGNKIPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLATSPFVVTNNSVSNGKIALTWDNKTGSITHFTDNGTTNYA
GSYNNQGLNSYWYVQGSDPNEAESNTEVHTKILENGAIMVKVLLTAEAPGANKLERIITL
YKDSDEALLENIVDKKPVRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDKGTPGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDTFNSVENEKYSAAFTQPLIAIPVNYKADIKGSL
FHMKNDKIVVTSITPQDDQSFIIRLYNPDEKEQTTTFTWERLKPSKLIYNKTGKEISIND
SISLNSMDVTEIKAIQ
Download sequence
Identical sequences WP_078781772.1.43920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]