SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_078797406.1.97548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_078797406.1.97548
Domain Number 1 Region: 656-928,975-1061
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.59e-28
Family alpha-mannosidase, C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 272-557
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000612
Family 4-alpha-glucanotransferase, N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_078797406.1.97548
Sequence length 1096
Comment glycoside hydrolase [Elizabethkingia miricola]; AA=GCF_002023575.1; RF=na; TAX=172045; STAX=172045; NAME=Elizabethkingia miricola; strain=CSID_3000516998; AL=Contig; RT=Major
Sequence
MTGNFIYAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRTTDGAKIIEW
ETAKVPQKNSGPYVYFNWLVSHSSGSSGGVRNFDLYINDQKTLTLSTYPANQHPTWTSKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPINKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDASATPFILKDGKRLINLTTLHFGPEEKITAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNVQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKEGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NENMFEVFEKKYGDQLPVVKGDISPHWEDGAMSTAKEEGINRNNGLKLQQLTTLYSMLNP
RLYNSQRFYNAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLDGNSLANQLEK
DLLQPLTNPGSKKIEVFNTSSWVRSGVVTIPAAAEGNSVQDAAGNKIPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLTTTPFVVTNNSVSNGKIALTWDSKTGSITHFTDNDTTNYA
GSFNNQGLNSYWYVPGSDPNKAESNTEVHTKILENGAVMVKVLLTAEAPGANKLERIITL
YKDSDEALLENIVDKKPIRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDEKMLIDNSHKKWKDKGTPGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDTFNSVENEKYAAAFTQPLIAIPVNEKADIKGSL
FHMKNDKIVVTSITPQDDQSFTIRLYNPDEKEQTTTFTWERLKPSKLIYNKTGKEISIND
SISLNSMDIIEIKVIP
Download sequence
Identical sequences WP_078797406.1.97548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]