SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_079990185.1.57826 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_079990185.1.57826
Domain Number 1 Region: 2647-2905
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.24e-18
Family Quinoprotein alcohol dehydrogenase-like 0.0028
Further Details:      
 
Domain Number 2 Region: 2108-2199
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000523
Family PKD domain 0.004
Further Details:      
 
Domain Number 3 Region: 2195-2281
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000209
Family PKD domain 0.0041
Further Details:      
 
Domain Number 4 Region: 1673-1762
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000497
Family PKD domain 0.0021
Further Details:      
 
Domain Number 5 Region: 1298-1413
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000137
Family PKD domain 0.0065
Further Details:      
 
Domain Number 6 Region: 2021-2110
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000017
Family PKD domain 0.0037
Further Details:      
 
Domain Number 7 Region: 1760-1848
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000523
Family PKD domain 0.0061
Further Details:      
 
Domain Number 8 Region: 1412-1500
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000667
Family PKD domain 0.0051
Further Details:      
 
Domain Number 9 Region: 1849-1936
Classification Level Classification E-value
Superfamily PKD domain 0.000000000288
Family PKD domain 0.0056
Further Details:      
 
Domain Number 10 Region: 1500-1588
Classification Level Classification E-value
Superfamily PKD domain 0.000000000562
Family PKD domain 0.0074
Further Details:      
 
Domain Number 11 Region: 1586-1676
Classification Level Classification E-value
Superfamily PKD domain 0.0000000235
Family PKD domain 0.0042
Further Details:      
 
Domain Number 12 Region: 2373-2454
Classification Level Classification E-value
Superfamily PKD domain 0.0000000353
Family PKD domain 0.012
Further Details:      
 
Domain Number 13 Region: 1934-2023
Classification Level Classification E-value
Superfamily PKD domain 0.000000654
Family PKD domain 0.0071
Further Details:      
 
Domain Number 14 Region: 2480-2539
Classification Level Classification E-value
Superfamily PKD domain 0.0000106
Family PKD domain 0.0092
Further Details:      
 
Domain Number 15 Region: 2557-2674
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000243
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Domain Number 16 Region: 1246-1330
Classification Level Classification E-value
Superfamily PKD domain 0.0000608
Family PKD domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_079990185.1.57826
Sequence length 2915
Comment hypothetical protein [Halolamina pelagica]; AA=GCF_900115675.1; RF=representative genome; TAX=699431; STAX=699431; NAME=Halolamina pelagica; strain=CGMCC 1.10329; AL=Contig; RT=Major
Sequence
MVWRMNRHRRLLAFTLAVCVVTAGIPLTGAFTSISADRSVSVSVASDADAFLALEPSAGP
NGAYAEQTDGTLELRFDGSGVIGDGLNPDAKTSFGDVFTVTNKGTDQVRVRIRDDTSDIA
FYTTIGETQYRLDGTNVSGAPLPVGAELNVSVRINSENASAIESVDTITIDATADEASDR
GADDNESTPPPGGSDGAPTTNIRNGELQLTGTAESGDSLRLDLATLPNASGDRIEAQSIR
INYTEQTSLRTTVDLNSTAGNDSGPGDVSPPENGTVLTYLNVSHPQTPDSAIGDATFRFV
VPHGEDPPGTVDLLRYNNTTATWETQPTEVSFVRNSTDGYVYEARTDSLSLFAVIERVRG
MLIRTEETSATIDASLLADPDSSFPVTAYGTYRNQSFNASYWDERATRNADDAAAVIREK
IGVSVREAAKDTLISKAVSIVDGVLKTSLRVSGIGSLLTALDITLSSSEFVGSFGPAIQQ
KTVAIHVDPGTASHDALRTKLAALEENSRELKTAVRNDNVARQNALLREREQLLEDTYRL
LPQYVDDVHTDVVGNTAGLEDPRAYKQIRSNAESLRMLLLLDHQVTTKRLYGAPDKSLAR
DTSMPTHGWTAFNRSEVYDTIDHTNDYVVLRINGSRAAAANNSLDIDIRGTNASAFETLL
VSERPDSPRRVEGREIDGVGSRASGVVAPEDEQYLVIRSDGAVGPLRVLVSAGNTTVPVS
VTERAGPDIQRPHADLIRSPEPVTLRDGDVVYPTNTSETRLAWQLWDDKTPTEEIEYRVR
VDRGEGFSAWTDWQFAPADGRVSPDLNYDAGITRVQLQVRDGSNRTAVRNADIVVSPGVP
QTALAAPDDPTSDAIYVRVLPERRIERIELQYRREGAETFKTWTNITDTRDIGRLSAPAE
GELVVRARAVGLDGDVSAWATERVTYEKRDTESPDAELVQAPALRPTPTQGGVAERRVTN
AAETTLAWDVEDDTTAADELEYRVRTTDGSWSAWRSTESGRIETTVDVLRDGTVVSLEVR
DAAGNVATRQVAVYRDTDAPSVSITARDSVLGAVVNPNADEPLRRVQLQVRGENQSEWRS
VRSLPGTQQETISVGSAGSYELRARGVDSAGNVGSWSEPVQFDSLPATYGESVINEETAV
AGGTVQEFNVGDAVVGAAQGYVLYNAFVDEIDGELLLNMYMLSREGNRIPVSSIELTEER
NQTIQADLPGNLTSDAKLQVEVRGNGTVVLASLRAIGAGPDVPPPTVSPERPTVDETVRL
SVPGDWPGENYVSTYQWDVDGDGAFENETASPSLNTSYRTGGTRNVTVAVTDVFGATRTA
NATVSVNSPPEAVLRAPTAIKTGEVVTLDAGGSTDPDGNLTAYRWSIDGADDRTGSETRV
SFADDGTYSVTLVVEDEDGATDRVTRAVSVENRPPQVTASVNETDPLVGEGVRFSADGSL
DTDGSITEVAWDLDADGTYERSGSQITKAFEEPGDKTIGVRVTDDDGATNTTTVRVHVNV
PPESRLNTSSPVLTNETVVVDATESTDPDGTIAAYQWEVAGPAAVPDGTTTDTLSYPDDG
VYPVTVTVVDDDGAIDTVTRNVTVENRPPEVNGEVVNETPVVGEPVEFTAAGSTDPDGTV
VSTGWDTDGDGTVETNGTQATAVYDSFGVRTATVTVTDDDGATSRSTVSFYVNAPPRASI
GSSSPALTDEPIRLRAIDDSDPDGQIVEYAWDTDGDGTPEADGNSTTVSFSDDGTYSVAL
TVTDNNGTATTVTRNLTVRNRPPRPVIDRNVTVPLIEEPVRFEAANSTDPDGSVTAYEWD
LDNDGEFDETGATVMTAFAESGNNTVTLRVIDDDGSTNTTAVRVHVNVPPESRLNTSGPV
LTNETVVVDATESADPDGSIVAYQWETAGPATVPDGARTDTLSYRDDGVYAVSVTVVDDD
GAVDTVTRNVTVENRPPEVNGEVVNETPVVGEPVEFTAAGSVDPDGSVVGTGWDTDDDGA
VEVNGTQATAVYDSFGVRTATVTVTDDDGAANRSTVAFYVNAPPRASISSSGPALTDEPV
QLRAVNGSDPDGRIIDYRWDVDDDGAAEVNGSSTTVSFPDDGTYPVALTVVDNNGTATTV
TRNVTVRNRPPRPVTDRNVTVPLVDELVEFEAAGSTDPDGSVTAYEWDLDGDGEFDRTGA
TVTTAFAESGNNTVTLRVTDDDGSTNTTNVTVRVNEPPVANITGPLSVPTGETLELTAAG
SFDPDGRITEYVWHLRGRSTTGQNLTTEFHDDGNYTVNLTVTDDAGATTTVTRVVEVTNR
PPSATLSRINESDPVTVGQPIAWNTSVGDADGTIDNVTLRLSPPSDTETTRFVPVTGAET
EIELNESGAWNLTLVAVDDDGARTVRCRTVDVNARPVAEIGVSKAPVAGEPVTLTAFAND
SDGTVESYEWVVGNRTLTGRDVTFTPETAGERSVTLVVTDDDGAERVVRRTVEIDSPLDA
EVYIEQFFGGHILSAYADIDTEDPGSVRYRWDVDDDGEYEATGGERVVSEPGTYEFTVRA
TNTETNKTVVANETVTVESLPADIRVNWTNRDTNGGELAADHGQVYVPAGEQGFNEDPAD
ASLTALSSETGTENWDVSLQFNPSDVRTTDDAVYAIGRGIARIDPDTGTVRWAIVPDGNP
EFTFTEDRLFISSEESVTAIDIATGETVWNRSGIDVDEQLVSDGRLVIADQEYGFPGEST
LVAYDTTTGDVLWNRTDNGTWDLNTAEDGPVIASDDGEIRAYDAGTGTLDWATMPQPNGS
TSLYIDRVVVRNGTIVVRGDDYPRGYVVGLAFDGSVEWSLGLNTDQQLAPGTDRVYAIGG
GNATAIEPSTGTVQWDRNVPIESSYPTTVGDSLRPIVVADYGLAIVLDPATGETLWRGPT
GGAIYRATYADGTIYIATDDGTYAVELLSDRLPSD
Download sequence
Identical sequences WP_079990185.1.57826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]