SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_080044314.1.9532 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_080044314.1.9532
Domain Number 1 Region: 107-303
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.9e-19
Family 4-alpha-glucanotransferase, N-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 541-933
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.55e-18
Family alpha-mannosidase, C-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_080044314.1.9532
Sequence length 977
Comment hypothetical protein [Nonomuraea sp. ATCC 55076]; AA=GCF_002057455.1; RF=na; TAX=1909395; STAX=1909395; NAME=Nonomuraea sp. ATCC 55076; strain=ATCC 55076; AL=Complete Genome; RT=Major
Sequence
MTSRLLQRSLGSPDYDGIRQALRDDTSTPVISVRGLEVRVAVLPLFTHDGRQAVRVSSTE
PLTHVLVGVDSASGSDVTLLVPEVDAPRTLTLECRDDAGVVGSARITVTPQRKWHVFVVH
HSHLDIGYTDPQGTVLRHHLDYLDAALRLAEETASWPDDARFRWTVESSMPALKWLAARP
REMVDSFAALARAGSIEVTALPFQLHTEACSTEELHRQLRFTAQLEERYGFATKSAMHTD
VPGAVVGLVDALNAAGVRYLAAAHNWAGRSVPYLHGGDKLTRPFRWRAPSGNELLVWFTD
TPHGMAYMEGNTVGLTDSYELADDLLPRYLSALATRGYPYGPGTFGWQGPDAPKEPYELD
VLHLRVQGAHADNAGPSIVPATIARRWNEQWAYPRLRSAVNSDFFEHVEARHHDRLAVHE
GDWTDWWADGLGSGARPLGYVRRAQSALRVAETLHTLAGVDATGQVDAAYDKVALFNEHT
WGAANPWEDAEEAGDSGGLQWTRKSSGAYAAQDDAADLLHAGVRRFAAALSEAGTEGGAL
ASFAVFNPGTHARTDVVRAFLPRDVVGVDVPIALVDARTGQPLPHHEELVDPDDWPTRPI
GRHIHAVVPEISGFSYVRVDVVPGESQAPEPVPLVTDGVIENEFYRVTYDVREGYLSSIF
DKRAGRELVNGDAAAGFGQYVYDRYATAPHFNHLSGHVGAHDRTLLGDRAIGTNAVIKEV
RRTAVGEKLVVELRGKGADWIRTTVELHYGVPRLDLTYQLAKQGTPAKEAVFLAFPFAAG
PPTAWELTGGVGGPDVPRVPGSAAYMLPIRHWIAFEDPELTVAWATLEAPLVQLGTIHMP
YAPFPPTLDHEDGTVYSWALNNIWDTNFPAQQQGETTFRYAVTSRAGAPGRRLGAEAAAG
LTEPFVGALITDSPASEETYVSVDHPDVLVTSLGWDGVRLQSLAAEPVEVRVSRPGHETA
EVTLPACGVAIVRGTRQ
Download sequence
Identical sequences A0A1V0ACS2
WP_080044314.1.9532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]