SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_080779449.1.26857 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_080779449.1.26857
Domain Number 1 Region: 648-1045
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.14e-27
Family alpha-mannosidase, C-terminal domain 0.0089
Further Details:      
 
Domain Number 2 Region: 265-560
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000111
Family 4-alpha-glucanotransferase, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_080779449.1.26857
Sequence length 1088
Comment glycoside hydrolase [Chryseobacterium sp. 6021061333]; AA=GCF_900169075.1; RF=na; TAX=1816690; STAX=1816690; NAME=Chryseobacterium sp. 6021061333; strain=6021061333; AL=Scaffold; RT=Major
Sequence
MYGQKKVPFFGKIESVSGYAREISGENISYFSAFPEHATQALLTRTTDGNKIIEWETAPV
PVKTSGPYVYFSWLVSHSSGTSGGERHFDLSINDQKALTLTTQPGNKQSDWISKAADSTA
FVFHQTKTDGLKDSYGIAYLRIPVNKVNPGKPLRLKLTGHAQNSRDWFMTYKFTFQEKMD
AVLTPFILKDGRRVITLTTLHFGKDQKITAKVNNQETYSFTMPDGVKSFEIPVPAKESSV
QLSVSSGKQQLYIKTLGVEKVVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNIYDALKMI
EETRNLPEEARFKWNVEALWDVENFMQKASPEDIQSFVKAVKEGSIGLSAMYANILTGLS
QPEELFHYTEYAQKLEKKYGLSVKSAMMSDVPGFAWSLVPALAASGVKYFSSGPNYLGKS
NPYLGDRVGHFVKNWGDRPVWWESPSGKEKILFWTAGRGYSSWHGVHPGDVFENGQKKIA
EYLEDLTRTNYPYEMVQWRYNIVADNGPIDPSVSKFVDEWNKKYESPKIVLSTNEKMFET
FEKRYGNQIPTVKGDISPYWEDGAMSTAKEEGINRNSSLKLQQLTTLYSMIDPGKYNADK
FYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKKQFSLDGNTLAHTLDEDLLKPIT
GSSSKSIAVFNTSSWARSGAVTISDMADGNAVQDSKGNQIPVQKLSDGKAVFMASDIPPL
GSAVYKVIGKEAKAASPFVISDTRVSNGKVTVEWDVNTGSITKFTDNTTINHAGNFNNQG
LNSYWYIPGSNPEEAVSSTNVKVRVLENGPVMAKVSLTSEAPGARKLERIITLFAGSDEV
SLENIVDKTSVRTKESVHFGFPFNTEFKNITVDAGYGNMKYLTDQLPGSNMDYWYSRRWL
DASSAKKGIQWMMIETPLMEASAMIDERMVIDSAHKRWKDKGVSGTTNWFSYAMNNYWHT
NYKADQEGPVHYHYALRPHDGFNSVDNEKSAAAFTQPLIAVRANEKVSAGSLFKMSNDRM
VVTTVTPQEDRSFLIRLYNPDEKEQINTFIWEKLKPNKLINLKTGKALSVNDSISVAGMD
VVEIKVIP
Download sequence
Identical sequences WP_080779449.1.26857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]