SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_081147552.1.8773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_081147552.1.8773
Domain Number 1 Region: 454-891
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.04e-16
Family alpha-mannosidase, C-terminal domain 0.039
Further Details:      
 
Domain Number 2 Region: 60-341
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000274
Family alpha-mannosidase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_081147552.1.8773
Sequence length 916
Comment hypothetical protein [Niastella vici]; AA=GCF_002077945.1; RF=representative genome; TAX=1703345; STAX=1703345; NAME=Niastella vici; strain=DJ57; AL=Contig; RT=Major
Sequence
MKLNKAENKKLKCGNDKKYAMKKSKLLFFSLSILCIVENNVWSQTTIPRKKQPDNFVLNN
NVKEIIVVFKTHFDIGYTHRAKDVVQYYRTGMIDNALKAMEASQSMPDGQQFKWTCPGWV
MSKVMEPWPGQTDERRKKLDDAFSKGRFITHAMPFTVETDVCEPEVITRGLGFASKLSRQ
YHLPLPQSAKVTDMPSHGGELATVLANAGVKFLHIGCNWPSGFVQTPGLFWWEGPDGSRV
LTFYSSIYSTAIGPGWSSEWGGNEHFVGHGLLPPADWPYKVWPAILVTMDNTGPPKERDV
KALFEEARKKMPGVNIRVGTMDDFVRSILAGNPTFPVVKKEMPDTWVHGIMCDPGGSKMS
RDAAPLLAADELLHTQLKNWKLPVSSISDSIAKAYEMMALYAEHTWGGAASVDKYGDEFK
QLPASKYAGLEASWEDKTDYIRTAWRIANNLKKDNLLLLAQSVKAAPNSLLVYNPLPWQR
NGVVDVNGEQVLVKNIPAGGYTTVALPAKQIAATSTSQFIENEFYKISFDATRGAITSLI
DKRTGHNWAANISGNQTGQYFNERFTYEQTAKYTADYQQKRAWQVFGESGDWLHPGLFKP
GMISEKIVPYRKASPVGGTLSVATTPLQQTAIVNMPADTANHLPASRLTVTLTGGQPYLD
MEITILNKAKDNWPEADWLALPFNIQNPVFKVYRPLGTMDPATDIQMGANKDMYTVGQGV
TITDATGKGIAVTPLDHPLISLDTPGCWKFSLNFIPKKPIVYINLYNNQWNTNYRYWYPG
TWSSRVRIWTFDRNTAKEQIMTVPALEARNPLQAIAPENSSRKLPATQKGIELSRKGVLV
TAFGEDPDGNKGTLLRLWEQAGSAGAVTIMLPAGQQRTKATPVDLRGEVNGKPVKIINGK
FSCTIKAFGPASFILE
Download sequence
Identical sequences A0A1V9G039
WP_081147552.1.8773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]