SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_081147580.1.8773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_081147580.1.8773
Domain Number 1 Region: 678-956,985-1070
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.18e-18
Family alpha-mannosidase, C-terminal domain 0.0085
Further Details:      
 
Domain Number 2 Region: 283-431
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000322
Family alpha-mannosidase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_081147580.1.8773
Sequence length 1106
Comment glycoside hydrolase [Niastella vici]; AA=GCF_002077945.1; RF=representative genome; TAX=1703345; STAX=1703345; NAME=Niastella vici; strain=DJ57; AL=Contig; RT=Major
Sequence
MKKGIFFVAIVFICNVVIAQLQAPYLGTVQWVNGYAKDVQGETISYFSAYPDYANIALLT
RCTDGAKVIEWETAPVPKKTSGNYIYFSWVAAHSSGTSSGNRNFDLYVNDQKVLTFTTMP
GNQLPTWTYAAPDSSRLVFQQTKRDGANDAHGLIFLRLPVARVKRGQFAKIKIVGAAQQS
NDWFMTFKFSFEEKADVEPMPFRLKDGKQPVALTVLHFGKEALAHVAINQKEAYSFLCKN
GVNHFEIPVNAVQQEDSLQVRVSIGQKILANRYIKLQPVIYRELHLIHHSHTDIGYSHLQ
PEVLRIQMKNIDDALHMIDKTNTLPDAARFKWNIESLWVVENYLKQASASQKEKFIRAVK
EGNICLSGLYANILTGLSEPEEVFHYTDYAAQLREQFGLRINSAMISDIPGYAWTTVTGL
AKGGIRYFSSGPNFMGETHPYLGDRAGHFVKAWGDKPVWWTSPSGEEKILFWTAGKGYSS
WHGTAIGGVFERGPKKIAAYLNELRLHNYPYDLVQWRYNVVSDNGPIDSTISEFVEQWNN
KYASPKIVLNTTEKVFEQFEQKYGASIPVVKGDITPYWEDGALSTAAEEGMNRRNSLRLQ
QLTNLYAMLAPEKYNPAHFYEAWKNILLFHEHTWGAYNSVSEPDKPFVTEQWRIKKQFLL
DAGEQIDQLETGLLNDFVQPGSKKIAVINTSSFVRDGLVVLPVGVTGNSVKDLSGKIFPL
QKLSNGSSIFWAGQVPPLGTTIYTITDNKAVPGYNGFHYTDSSVSNGKITLRWDKKGSII
QLSDSTGFNYAETFNGQGLNSFWYVPGLDPAKALTNDAVQVKIVENGAVAITIAFVCNAP
GVNRFERQITLYAESNEVVIENTIDKKAIREKESLHFGFPFRSSLNQVTLDAGYGTIKYL
ADQLPGSNKDYLYTRNWLDLSQSDKGIQWMVQEAPLLEPGSMIDERRTIYGAHKEWKSEG
NITSTWFSYIMNNYWHTNYKADQDGVSSYRYCLKPHGMFSNSETEKAAIVFSAPLQGWLV
KEEAALPGSLFELSNARIVVTSVTPLKEGGYTIRLFNPEPAAEQTNFRWGKLRPSQLINS
QNGKIMAAGDSIMLPGQGVIDMKLVP
Download sequence
Identical sequences A0A1V9G020
WP_081147580.1.8773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]