SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_081535460.1.90868 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_081535460.1.90868
Domain Number 1 Region: 664-823
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000719
Family Tropomyosin 0.0058
Further Details:      
 
Domain Number 2 Region: 197-396
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000118
Family Tropomyosin 0.0031
Further Details:      
 
Domain Number 3 Region: 815-1016
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000311
Family Tropomyosin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_081535460.1.90868
Sequence length 1136
Comment hypothetical protein [Lactobacillus salivarius]; AA=GCF_002079425.1; RF=na; TAX=1624; STAX=1624; NAME=Lactobacillus salivarius; strain=JCM 1047; AL=Scaffold; RT=Major
Sequence
MEKKNVLKTGALIATAAVSTTLGVNAKADNVTTTNETNNISSTTSTPTTLEQAQTDVNNK
QAQVDATQNEVNTANEDVTKAQNNVNTSNNEVAKAQDAVNTANEEVTKAQNNVANATDEN
INATKDGISNQQNNVNKAQQAITDAQNNVNEKQSEVNVAQSELDKSNNDVSSQQSNVAKA
QQAVTDAQNAVNNKGIDKAQQAVNDAKNIVNNDNDKISSLNNQITDAKNNVKQAQNAVNN
SKDTLDKSKNTTQTAQNTADNAKQELDTMEGIAKVKQNNVNKAQQAVQQAQDAVNNLGID
KAQQAVTDAQNAVNSDNSNISNLNNQVTNAQNVVQQDQTKVDSINKDINATQQTISNLNQ
QVQNASKEVSDNQQKVDSLNSQVQKAQDKVTDLSTKAVPTISFTPEQIKATQDLVQALKD
YEKQGNSAVNAIYGYDDNATEIKLLKQKWLDVMTDSSKIIDWKDNNESDQNTALDPNNLT
AEQATDLSNFVATIINQMRVSLGINNDVGDVLVSKGSVQLALTVAKNTFNDKWAYVDHDR
KALNKAFSEFGINGGGAEDASWNSGDFFAKPTIASFKNDIFHAIQQMMFEDGDQDMGHTV
SLLGLINVSNSDKPSYLGVGTNYLYDDEGNVSDVSMFHYNIVDPLSYLDDINTDTEVLKS
KGMFDTVNNPYTDLASALQQAESELSDLQNQLSTAQNTLKTSQDNLATQQSTLATQENKL
SDLQNQLSTAQNTLNTDNINLNSLKSSLQQAQTKLSLDQTILQQAKETLDSYTADAKAKL
ANLKQAQDNLAAEQDRLNDAMITLKEKQTTYSNAQANLQQAQDNQAKAQADYDNAKNELA
KSQTKLASLQADLQQAQDKLTKDTETLKQAQDTLNVYTQDNAQKLANLKQAQDNLKAEQD
KLTDLKNIVDGKKDTLSKKQAALSDAQEALKVAQDNLKAEQDKLSSLQQHLSDLENAPKL
LAEAQDKLAQAKETLAKAQADYEAAASVLSDKQATLEEKQAALEKAQTALAQAKQVLASL
QAIKDAEDKAKAQAEEKAKNTHFAQTANGKVVDEKGNIMVGYSVKGNQVFDAQGKLVGTL
AQTSTTRRMANTVKQENAKVLPQMGNKQNNATTVGAILVGLGSLLGLGVLGKRKED
Download sequence
Identical sequences A0A1V9R823
WP_081535460.1.90868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]