SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_081819451.1.50062 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_081819451.1.50062
Domain Number 1 Region: 744-1185
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.87e-42
Family alpha-mannosidase, C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 343-537
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.2e-26
Family alpha-mannosidase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_081819451.1.50062
Sequence length 1207
Comment hypothetical protein [Maribacter sp. Hel_I_7]; AA=GCF_000688315.1; RF=na; TAX=1249997; STAX=1249997; NAME=Maribacter sp. Hel_I_7; strain=Hel_I_7; AL=Contig; RT=Major
Sequence
MKHRIKPILRILCFLNLTVALNNINANWDNERNVLVDNSTNVFFHEGNGNGHIQELNTNH
KLWSYIKNDIEGYKEMISGSEFFLYPSIREDINVSMIARATTGKMGFEFLTGMVPSDYNE
DTVTFFMLSDIDLNLHQSFDIHVNNKHVLTFNTNDDGSLSITENPAKGNAEYILVSRDAN
GDGIGGFRLTVPTNWVKKGESAKIKFNGHKKNSNCWVMIFKADDAVSRIKESIKSEAAFV
IKEQSGVLYVDAPAFFNGKKVYAISDGKKSKIKSFKTQGELSKVSFNIQSPKKDFTLVYD
GVELNIVFKNDDGTISKTEIIGNYLLHHQAKNKGGNWYASLTKLYKPEFNETYDDFFEKR
YENGLISVMNSSHQDIAWVDRPEVCIILRDTLLLAPVLKDAFIRDDYGFDIEDGLMLREY
LNRHPESKEQITTLLDKKLISVGATYNCPYEDMYDAEDQVRQLYLGKKWVKKNFGGYDSK
VYWNVDVPGRSLQTPQILKKAGVDYMIISRHAKGMFHWASPDGSSVFTYSPGHYGNDLLY
LSRDMTNKKKYAADQTLYWKDTFSGGEIQTPLLSSQDMLPAIDYSDYIENWNNFDSIVDT
DGQNKKLFLPKMELKTVDEFMPLAEKNAVNVDTIMGERPNVWVYIHGPGHHDALTASREA
SKLLPAAEKFLSVANILEPHKIQYPFEKFDEAWQAKIYPDHGWGGHDGDITDDLFRENLV
KSRTIGQSLLNVGTSFISRRIKKQEKQGIPIVLFNSLSWKRSDPVTTTMKFVQGAIKNLG
IKSSNKDNIQVQTSNTTYFDDGSIQSTDVTFIAEDIPSIGYATYYVQDVKENKNDTSVEI
EKNLQYENSYYKINFEDGGLSQVYDKEFKRELFLNDNFKVGDVFTMESIGNGAGEFGDVQ
QPSMMDFDKVSLHNTKWQVIESGPVYIKYRLEQQILHSIVRQDVTLYHNLKRIYFDTSLR
NWSGELYREFRTAFPINMNNPEIAHEVPFGSVRVGKDEIKTAGERYTPLCKDVHPRAIID
WISASDDELSITISSSVAAADWVDPTDHESHQAVLQHLLLASRTSCHWEGNEYSQAGNHD
FTNVLTSNIAGSVEGQRIAKQKNEPLFVVLNPDTVEDASLPETTSFYEIDSDNVIITTIK
KAEDGDNIIARMYNVKDTQETINLSSYFKILKYNKTNIIEENPIEILPELNVGEYAIETF
SLEINEK
Download sequence
Identical sequences WP_081819451.1.50062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]