SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_081907334.1.12541 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_081907334.1.12541
Domain Number 1 Region: 534-933
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.21e-31
Family alpha-mannosidase, C-terminal domain 0.0077
Further Details:      
 
Domain Number 2 Region: 109-313
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.78e-18
Family alpha-mannosidase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_081907334.1.12541
Sequence length 973
Comment hypothetical protein [Flavobacterium gilvum]; AA=GCF_001761465.1; RF=representative genome; TAX=1492737; STAX=1492737; NAME=Flavobacterium gilvum; strain=EM1308; AL=Complete Genome; RT=Major
Sequence
MNNMNKLTSLFALFLLLQGNLNVFAKTSFSDSLMVKVQSFYRHRPDKKPGRSLMLYFKNA
PLKGKGTVTLQSNSIKELLPIDGKNGIDSLNVLLPAGLGVKTDCQLKIVVNQSNKVLERS
VKVPALRQWTVYIYPHSHVDIGYTNTQENVETIHKRNIFEGMELAKKTATYPEGARYLWN
PEVLWPVERLFSKASPQAKQKVIDAVKKGYLQLDASYVNTNTSVAVDEELFEFLEHSKDF
EKLTGKKIETFVQVDVPGMTWGLVPVASQLGIKYIMAFNNGFDRVGRSMDLMSFRPFWWK
SIDGKSKVLFLQPGSYSPGAAAKGFDYWPKMAGQIDSTKLMKVVRTDTPRKHFIDKYLAD
MLPKLQKADYYPYDIFAMSWAMADNMPIDADLPEAVKSWNEEYAYPHLVIAGATTIMKKF
EEKYGNQLPVLSGDYTEYWTDGLGTAAKQTGMNKSTKERLIQDETLWAMLHPGEPAPRAD
LKEAWRNVSLGTEHTWCYMDPSKQPITNDILNVKFGYFQKGEDISKDLMQRALAPVAKNE
SEIVGVFNTLSWNRSQLVKLSKEQSGRYNSVKNESGKTVLSQKLSTGELVFMAENVPALG
SKNFMLSEEKNNASGMLAHDNVLDNGSIKVVLDPQTGDISSLTKGANEFVDAKAACSINS
YRYLKSSDTLNRVSGTSNVKISILENGPLLASILVESAAEGSNSLSRTITLVKDQPYVDI
KNNLDKQSITKKEGVHFGFAFNIPQPETMVDIPWGIMKIDNDQLDGANRNWIGFQRWLDV
SNKEKGVTMCSLDAPVFEVGDLTADILGGAANSPKWIKKLTPSATIYSWALNNHWHTNFP
LSQEGKLEFRYRLLPHNTAYDAGMANRFGMEQSQPLIVSPLKQKISQKPLLSLSDNPKVL
LSILKVDESGKKMEVRLRSVSDKDEQVKVNWLEMKPTSIQIDNKAIGKGKNPMETEVLVP
AKGMITLVADFIR
Download sequence
Identical sequences WP_081907334.1.12541 WP_081907334.1.75928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]