SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_081991014.1.57028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_081991014.1.57028
Domain Number 1 Region: 116-413
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.38e-60
Family Carboxypeptidase T 0.016
Further Details:      
 
Domain Number 2 Region: 523-623
Classification Level Classification E-value
Superfamily PKD domain 0.000000000876
Family PKD domain 0.003
Further Details:      
 
Domain Number 3 Region: 632-706
Classification Level Classification E-value
Superfamily PKD domain 0.000000432
Family PKD domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_081991014.1.57028
Sequence length 747
Comment hypothetical protein [Pseudoalteromonas sp. OCN003]; AA=GCF_000788395.1; RF=na; TAX=1348114; STAX=1348114; NAME=Pseudoalteromonas piratica; strain=OCN003; AL=Complete Genome; RT=Major
Sequence
MSSYLSELVFMLIGGNMLRTLLISGLMLGAVNSYAQQSQHFLVTFPNTDIENRAKISLHH
NLIGDRPNGVLFTLTKDEQSLLKRFGATLQPANNLAKQFLTKQQNIFDKLINNNTGIPGF
SCYATVEETFQQVDDLVAAHPEYTELVDIGDSWQKQNKGEGYDLKVLKIGKKDLVNPPIL
FIQSAMHARELATAALTLDFAKQLLNERESNPDINWILETQQIHILFQTNPDGRKIAETG
VSQRKNVNENHCVESSVGVDLNRNFSFGWGTVDGGSSGDACAATYRGDAPGSEPEVAAVE
NYVRSIFPDQRGPNVSDAAPENTQGLYLDIHSYSKLILWPWGGSYDAAPNAKGLESLGRK
LAYFNNYTPMQSVGLYPTDGTSDNLAYGELGIAHITYELGTAFFQSCSHYNALIKPSNLK
SLLYAAKVTKAPYQLSQGPDIEGVTLSNSNGKLVISATATDTRFKNNSSWPMHNITKVRY
AFNDLVTDENAQLASLTDGNADSISEQFAIEVREGELINNKATVYIQAQDSEGYWGTITA
HSIDTNPPSVAGNINCSGAKCQFNVENSVSGFNYQWQLSNGEVLEGENPTHILPSMGDYS
ATLVVTNSMGISNSQVLDFAVSELLAPEAVVTHLCNYLVCEFDASNSSDADSKTLTYSWT
AEESAGSGEVFTHTFSQAGSYKVVLAVTDEHAQTANYELDLQVETEPEPVPLPEVPGDVK
KDSSGSSSLFGLLLLTAGALIRRKTLN
Download sequence
Identical sequences WP_081991014.1.57028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]