SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_082089166.1.43275 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_082089166.1.43275
Domain Number 1 Region: 17-340,399-438
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.28e-50
Family Quinoprotein alcohol dehydrogenase-like 0.0015
Further Details:      
 
Domain Number 2 Region: 787-1139
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.73e-45
Family Quinoprotein alcohol dehydrogenase-like 0.0018
Further Details:      
 
Domain Number 3 Region: 515-598
Classification Level Classification E-value
Superfamily PKD domain 6.02e-29
Family PKD domain 0.00022
Further Details:      
 
Domain Number 4 Region: 604-687
Classification Level Classification E-value
Superfamily PKD domain 2.88e-25
Family PKD domain 0.00027
Further Details:      
 
Domain Number 5 Region: 420-509
Classification Level Classification E-value
Superfamily PKD domain 6.15e-24
Family PKD domain 0.00058
Further Details:      
 
Domain Number 6 Region: 693-786
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000259
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_082089166.1.43275
Sequence length 1293
Comment cell surface protein [Methanosarcina siciliae]; AA=GCF_000970085.1; RF=representative genome; TAX=1434120; STAX=38027; NAME=Methanosarcina siciliae T4/M; strain=T4/M; AL=Complete Genome; RT=Major
Sequence
MKIFLICLTLLLVTAAQPVLGSDWAQFQRDVYNTGVTADRAPITDPMNSTLSWEYKLGGN
VDSAPIVAGDMIYSVAGNNHIYAFNRTTGELVWEESTSGSLGFLIGNAAVGNGIVFVPTS
NGQIFAFDAETGSQKWNKALNSKQLDTPIVYSDGKIYFGEAMGGRNYYCLDENGNEVWSR
TATTQENSQGSYYWAGAAVIGDYLVYGDNDGHIVSVNKDTGTDIAEINVSEEFGVDCKEI
RSSILYVEDPGRVYFTSTGGYCFALGFNPADGTFNTSDKHSVNIAYASTTTPAYYNGRIY
IGSGEIMKSNGNGVYCLDADLTGVIWNYPVGGTGIVQSSPAISTYYDNGDGEVYIYFTVN
AKPIGGVYCLKDLPDSTSPELVWSYIESGKTDFSLPGVAISDGWVYYGTDNKYIFGLTTP
DSQVPEAPTADFSASPVSGDAPLTVSFTDLSTGDGITAWAWDFDNDENVDSTEQNPSYTY
SNAGTYAVSLKVTGEGGSDSEVKADYITVSESSTPVEPVAAFAADVTSGTAPLTVNFTDQ
STGSPTSWAWDFDNDGNMDSTEQNPNHTYSDAGSYAVNLTVTNEDGSDSELKTDYITVSE
SSTPVEPVAAFAADVASGTAPLTVNFTDQSTGSPTSWAWDFDNDGNDDSSEQSPSYTYND
TGSYTVKLTVSNENGSDALEISGMITVKEIVISEDTWYQFHKDAQHSGYSSSDAPDSANL
AWIAGPLNDTYSLVPSSSVVIAEGMVFGLCNGAVDDYGNPLTSEGQLVAFDEETGEEIWN
VTVMAPEWGSWSCPAYNDGKVFASAGKNTYCVNASTGDILWTFQNPSELASCNGGPAIGD
GKVFASDWDGGNYYCLDENTGELLWTFKVDGLYAQSTPAYKEDRVYLSGWTTVNAVYCVN
ATTGELIWENDELSSNPCGSITVTDEGLYLSIYSFGTEDGFYKLDLNDGHEIWGRPDIPP
TDSTPAVVNGKVYLSAGTAGYSDLNTYCLNASDGKTIWVTDSSENIGDWVCSPAVADGKV
FTGGAAEGLFTGSSTLYAFDAKTGTVIWSYKGCGGSPAIADDMVFSTGSGKLYAFKEAEV
PLPEANFSSNVSSGEAPLTVGFTDESTGEGITDWAWDFENDGNVDSTEQNPVHTYTADGN
YTVNLTVTSAAGSDLEVKTDYITVEEASSGSQNGSSNVSLNVTIVPVISLEVSPSALDFG
ELYPGKTSELQNLTLKNRGTCDVNVTAIVCDYSAGDELFSQGLLLDSQIWNNYWKVVGKN
SQENTSVALKVPADYAGSGNKKGTITFWAEAAE
Download sequence
Identical sequences WP_082089166.1.43275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]