SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_082795620.1.58599 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_082795620.1.58599
Domain Number 1 Region: 664-955,986-1097
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.45e-25
Family 4-alpha-glucanotransferase, C-terminal domain 0.078
Further Details:      
 
Domain Number 2 Region: 278-570
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.5e-17
Family alpha-mannosidase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_082795620.1.58599
Sequence length 1116
Comment hypothetical protein [Flammeovirga sp. SJP92]; AA=GCF_001583495.1; RF=na; TAX=1775430; STAX=1775430; NAME=Flammeovirga sp. SJP92; strain=SJP92; AL=Contig; RT=Major
Sequence
MNQLNYRHLMIVLMCIITTQLSYAQDKLFLKGYTDYIKGDIMPYKSPQEDANQAMLVRCS
EGKNEMEWEAEAVPTSYDGEYAEYGVIMGVDIDRAQYDFDFYINDKKYFTFTAPEESILQ
DVTADGPNGSKLTFKGTMIDAYSDMFGYGFLKIKTADLPKGKPVKMKVVAPTIGKSSWFM
MFKYGVDGNVSWKQEPAVIKSDKGPKQQLRATILHYGDPALATITAGKSKEKVTLNVGAN
VFRVNIPKVEETTSIPVKVTVGKKVLDEQVLEVEPVKPYTVYLLHHSHVDIGYTHTQDEV
EKMQWKNLDDAVMMSKKTANFPEGSQFKWSVEVMWAVESYLKNVSPEKRVAFLEAVKDGS
IELNGLYGNMLTGLSNPQELVESTFDALQVANETGAPMESAMITDVPGYTWGLVPVLAHS
GVKYLSAGTNVFHRIGGTISTWGDRPFYWASPSGEEKVMVWVHEKGYSHFHTGLGFTDLK
VLLTPKSVFDYLNELNERTYPYDITTLRYTVGSDNGPVDTGISETVKEWNDTYETPKVML
STTTESFKAFEDKYGDQLPVVKGDFTPYWEDGAGSTSAETALVRNASEKLSQAMTIMSLN
GADIPNETFEQAWRYVLLYNEHTWGAYNSISEPEADFVHSQWAVKQSFAIKADSIADELL
ERALAIGEKTKGILLTNTLNWDRSELVRLSAEKTSNGDYIVDQDGKYYPTQRLSNGELAV
YVDHLPAYGQLELFSTAEMKCNKECKKCKDCKNCKKCNGQKALKVADNTIENDFIKLEIN
AENGSVASLYDKVRKKELSDNSELKGLNDYYYVAGRSPKSPLTTANDIQIKWLEKGDLVS
VIEVSSSAPGTEEWKRTFEVNAYSEVVAIDNQINKTNVYDPEGVHIAFPFNVKNGTVRID
APFGEYIPEKEQLQGSCKNYFTVQRYADVSNLDHGVTWVTPDAPMIELGEITTDALSYGW
VQEVKPTQTIYAYLMNNYWETNYKASQEGWHSFRFMLRPHGAYVSTDAKKFSMAVAQPIL
ISENENDNYTAFIQPTANDLIITASRPMDKEHVLLTVLNANAGDSILEWTASDKVEGVYL
SNINGDNKGAFQQGENIPGWGVRFLLVKVNGESASK
Download sequence
Identical sequences WP_082795620.1.58599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]