SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_082886437.1.21069 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_082886437.1.21069
Domain Number 1 Region: 678-954,994-1078
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.85e-25
Family alpha-mannosidase, C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 292-440
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000556
Family alpha-mannosidase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_082886437.1.21069
Sequence length 1115
Comment glycoside hydrolase [Flavisolibacter sp. LCS9]; AA=GCF_001644645.1; RF=na; TAX=1492898; STAX=1492898; NAME=Flavisolibacter sp. LCS9; strain=LCS9; AL=Complete Genome; RT=Major
Sequence
MLPNNVFKTIKHSFLVFTAFLFTQQTTAQKSVPYFGEIKWINGYAKEITGENIGYFSAYP
DYATVALLTRCTDGNKVIEWETAPVPKNIKGNYVYFSWVAAHSSGTSKGDRNFDLYVNDH
KVLTFTTTPNHQNPNWSFAATDSSRIVFQQTKRDAANDAHGLAFLRLPVSKLKPGEPVKI
KVVGQAQNSNDWYMTFKFSFEEKVEVAPVPFMLKSGKQPVVLTALHFGKDQHLQVKVNRK
GNHSFLIKDGVNTFDIPVNAVQKNDSVFIQVSAGKNVMVSKYVLLKPVVHRELHFIHHSH
TDIGYSHLQPEVLKIHIKNIDDALHMIDATKNLAKEARFKWNIESLWAVENYLKQASPAQ
TERFINAVKEGSICLSGLYANILTGLSQPEEVFHYTDYAEQLRKQYGVKINSAMISDIPG
YAWTTVTGLAKGSIRYFSSGPNFLGETHPYGGDRVGHFVKTWGDKPVWWASPSGEEKVLF
WTAGKGYSSWHGTPVGGVFDKGAKKIAAYLNELTDKNYPYEMVQWRYNIVSDNGPIDPSI
SDFVDQWNKKYASPKIVLNTTDKLFEAFEQKYGNSLPVVKGDITPYWEDGAISTAYEEGK
NRVNSLRLQQLTTLYAILDAKKYQPSSFYEAWKNILLFHEHTWGAYNSITDPDIPFVTEQ
WQIKKQFMLDGDKQINELEKNLLAPLTDSLSKRIAVVNTSSWARSGMVTIPATINGKSVR
DAVGKKWPLQKLSNGTYVFMANQVPALGAAVYTITNEEADAIKNNFTVTNNAVANDKIRM
EWDQQGSITNLTENGSFNFAGSFNKQGLNSYWYVPGFNPTDALTNSHVQVKVLENGPLVL
SLVLLSDAPGANRLERKITLYAGSNEVMIDNLIDKKAVRQKEGVHFGFPLHPSLNKVTLD
AGYGSMQYLANQLPGSNMDYLYSRRWLDVSTADKGIQWMLLEAPLVEPGAIIDERQTINQ
THKEWKKTGSPTATWFSYVMNNYWHTNYKADQDGVSHFRYALKPHGPFSYTETEKAGASF
SQPLLALPVKEQVTFADGLFDLSNNRIVVTSLTPQEDGSIVIRLYNPEASTEQTNFLWKK
MRPSQVIHLGTGKKFSVNEPITLAGMGVMEFKITQ
Download sequence
Identical sequences WP_082886437.1.21069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]