SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_083344008.1.41223 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_083344008.1.41223
Domain Number 1 Region: 507-956
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.79e-29
Family alpha-mannosidase, C-terminal domain 0.022
Further Details:      
 
Domain Number 2 Region: 123-406
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000723
Family alpha-mannosidase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_083344008.1.41223
Sequence length 961
Comment hypothetical protein [Terriglobus roseus]; AA=GCF_900102185.1; RF=representative genome; TAX=392734; STAX=392734; NAME=Terriglobus roseus; strain=GAS232; AL=Chromosome; RT=Major
Sequence
MQRRDVLKGFTAAMGSALITQQGWARGLEQSAPPIAVPIRGYVRKNSKLMQPVRITLPSA
RAGAEVVVKIDGEEHDRRKLASADQAFEIFVEPVSKPQRTRVSLTIDGVEHAAEIERKPV
RQMKVYVLPHSHHDLGYTDLQAAVEEKQINNIVQGIELARKTSEYPEGSRFVWNLEVLWG
ADLFMKRRSASDRTALIDAIKKGWIALNGSYANELTGLCRPEELVELFRFGTQLGKACGV
PVRSAMMSDVPGFSWGTVTAMAQAGIRYFSAAPNYFDRIGTFMVEWQDKPFWWVSPSGKE
RILFWVPWTGYAMSHVMKLGDEWVDKYQDRMDEVGFPYDISCIRWSGHGDNAVPDPELSP
WIKRWNETYEWPKFHISSTETAFSAFEKAYGDKLPEHRGDLTPYWEDGAASSALETAMSR
NAAERITQAAALAAAFHPESYAPDKYNEAWRNVLLYSEHTWGAYCSVSDSENPFTLKQWA
VKRAFAVDAAKDADTLLADALGSGSTTTSAAEVDVYNATSWSRSEVVLLTKEQSHAGDHV
ENAHGQAVPSQRLASGELALWVESIAPYTKRRFRLSSKKPARPAHAVSVRGDVLENEKLR
VKLHPDTGDIVELMQHGDAANLVDTKNGAANQFLFMAGNDTERLGHSGKATITVEDPGPL
VATVLIRTTAPSCNGLTRRVRLVAGMDFVALENTVDKQRAALNPNPGKGGQGGEFAQRGS
KESIQFGFPMQVPDGKMTLDVPLAVMQPEVDQLSGSCKNWLPVGRWVDLSSQVRGVTWAT
LDAPLLEVGGITATMLGSQKNPAVWRKHIEATQTFYSWVMNNHWGTNYRAYQQGPVTFRY
ALRPHRGNSSSETERFATGLTQPLIAAPASGSASASEPMLHVSPQEVLVQSLKPSDDGKA
WIVRLFCSSGEKQQATLTWADRAHAGKTWISNLSEETVQAVDASIPIYGWQLVTIRVERN
V
Download sequence
Identical sequences A0A1G7GTU8
WP_083344008.1.41223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]