SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_083692266.1.3967 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_083692266.1.3967
Domain Number 1 Region: 729-1192
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.05e-44
Family alpha-mannosidase, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 332-533
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.67e-25
Family alpha-mannosidase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_083692266.1.3967
Sequence length 1193
Comment hypothetical protein [Seonamhaeicola sp. S2-3]; AA=GCF_001971785.1; RF=na; TAX=1936081; STAX=1936081; NAME=Seonamhaeicola sp. S2-3; strain=S2-3; AL=Complete Genome; RT=Major
Sequence
MTFKINKVIQHLFLILSILLATCTSFANMLPNLLYHGGGTNVSHIQELNTNYKLHQICKD
DIEGYKKMLSGSEFFLYPSLREDLNISMIARATTGKKGFEFLTGEVPKNYSKDMVNFFFL
SDIDFNLRESFDIFVNDQHLLTFNSNKDGSLSITENPGNGNAQYFLVRRDANGDGLGAFR
LSVPTPKIIKGKSAKIKVVGRKKNSNCWFMIFKGTDVVERINKSVTEEMAFSIKQKDNVL
YVDAPAHFAGNPIQLISDGKKSKPKTFKSQGELAKVSFEISPPKHSFKVIYNNETITVTF
EKGDGSGMKTDIVGSFLYHHITNYNPYWTASLAKLYKPEFFDTYDNFFDKKYDKGLVSIM
NSSHQDIAWVDRPSVCIILRDTLLLAPVLKDAFIRDDYGFDIEDGLMLREYIDRHPGSEA
QITELLNRKLVSVGATYNCPYEDMYDAEDQVRQLYLGKKWVKKTFGGYDSKVYWNVDVPG
KTLQYPQILKKAGVDYMVISRHAKGMFHWASPDGSSVFTYSPGHYGNDLLYLTRDMNSKM
KYGAEQILWWENSFEDGKIHTPLLSSQDMLPAIDYSDYIDTWNTFDKVKDSNRKEVEVNL
PKMELMTVDEYLPLAEQHATKVDTIMGERPNVWVYIHGPGHHDALTASREGSKLLPAAEK
FLSIANKLDPVKTPYPFETFDEAWQAKIYPDHGWGGHDGDVTDNLFKENLIKSRTMGQNL
LNEGLNIIASKIKKNEKIGIPIVLFNSLSWERTDPVTTTLQFPKGYKNGITIVNKDKKII
PSQITNAKYHDDGSLKSADVTFIAKNIPSIGYATYYVKNKKTTFANNTNVSKSVYENPYY
RINFEKGGMTSVFDKELNKELFDNSVFKTGDVFTMQSVGNGAGEFGDIQQPTMVDYDQVS
LHNTDWEVLENGPVYTKYRVEQQIKHAIVRQDITLYHDLKRVYFNTSLRNWSGELYREFR
TAFPVNMENPEIAHEVPFGTVRVGKDEIETAGERYTPLCKDVHPRAIIDWISATDNEVSI
TLSSSVAAADWIDPTGKTDSNILQHLLLASRTSCHWEGNEYSQGGNHDFHNVLTSTKAGS
VSGQKIAKQKNEPIHVVVNPITASKPYLPQNLSFFSIDADNIIITTIKKAEDSEDFITRM
YNVEGSTETVNVSSYFDIKSYHHTNIIEENPVPVSPQLEIGKYAIETYSLKVD
Download sequence
Identical sequences WP_083692266.1.3967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]