SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_084080449.1.3064 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_084080449.1.3064
Domain Number 1 Region: 516-946
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.26e-28
Family alpha-mannosidase, C-terminal domain 0.021
Further Details:      
 
Domain Number 2 Region: 123-415
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000523
Family alpha-mannosidase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_084080449.1.3064
Sequence length 973
Comment hypothetical protein [Edaphobacter aggregans]; AA=GCF_000745965.1; RF=representative genome; TAX=1121860; STAX=570835; NAME=Edaphobacter aggregans DSM 19364; strain=DSM 19364; AL=Scaffold; RT=Major
Sequence
MRDSEGAKMKRRDLLKSLTMAAGGALLPNESVAQTEKQPTAKNPAVIPIRGLLRKDGKLV
QPIQISIEKPDDAVMAVTKLDGTEIDRRNVPAGEGSFEIYVKPVTSNQRSTIIVDLGGKE
VREEIELKPVRQMQIYVLPHSHHDLGYTDLQADVEAKQIRNITRGIELARKTKDYPEGAR
FVWNLEVLWGADLYMKRGSEGDRRELIDAVQKGWIGINGSYANELTGLCRPEELLQLFHY
SGQLGKTCGVKVDSAMMSDVPGFSWGTVTAMSQAGIRYFSAAPNYFDRIGTFMVSWQDKP
FWWVSPSGKEKILFWVPWTGYALSHVMKLGSELVAKYQDRMDEIQYPYDVSYIRWSGHGD
NAEPDSELSDWIRDWNQKYEWPRFSIATTSTAFSAFEKRYGYQLPQYRGDLTPYWEDGAG
SSALETRMSRNAADRINQAEALRAVTNKADYEVAEYAEAWRDVLLYSEHTWGAWNSVSDS
ENPFVKKQWDVKRAFAVDAERLSQKLIEKSVGLTSETSRGGQVEIFNSSSWVRSEVVYVP
QQLSQAGDYVSGHDGKPLPSQRLASGELAVLVSQMSAFSASRYSFSKQAAHHPSKPASFK
NNVLDNGIVHAKIDPATGDITELRLPSVAHNLVKTDGPYRANQLLFLAGQDVDQVQSSGA
AKITIEENGPLVVSVLVESSAPTCKSVSRRIRLVAGADYLELANTVDKLSAALNPHPGSG
GPGDEFAQRGSKESIQFAYPLAVSDGKMRVDIALGNMQPEIDQLPGSCKNWLPVGRWVDV
SNDEVGVTWVTQDAPLIEVGEISATMLGSQRNPNVWRKSIEPTQTFFSWVMNNHWGTNYR
AYQEGPVTFRYALRPHSRYDAAAATRLAIGLSEPLKVRAVSPSAKPIDSFLSIEPSDVLA
LTFKPSEDRSAWIVRLFGASGERRTAQLKWLRSGEAKFWQSNLAEEKLEPIGSEFEIAGW
DLLTIRIEELHSR
Download sequence
Identical sequences WP_084080449.1.3064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]