SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_084288813.1.84050 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_084288813.1.84050
Domain Number 1 Region: 472-739,799-908
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.04e-17
Family alpha-mannosidase, C-terminal domain 0.052
Further Details:      
 
Domain Number 2 Region: 83-269
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.48e-16
Family alpha-mannosidase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_084288813.1.84050
Sequence length 918
Comment hypothetical protein [Pedobacter nyackensis]; AA=GCF_900176505.1; RF=representative genome; TAX=475255; STAX=475255; NAME=Pedobacter nyackensis; strain=DSM 19625; AL=Scaffold; RT=Major
Sequence
MATKKINPTAICSERQVKHFVYIVAYKEKLCKLVSKCIFPALLITASLSAFSQNYNKPIS
PIPVPASVSNLLPGKKAPVVTDIWVVFKTHCDLGYTMSAGAVFKKYRENMMDNAIRLIEA
DKKKPVDERFKWTIAGWPMKGAILGPLQTPERKQKVEQALRDGTMSVHALPATMESDVME
QEDYVRSLIFSSQIARDYGHKLPIAAKMTDVPAHSWLLPTLLHHSGIKFLQIGCNYTVQP
VRLPQLFWWEGPDGSKVLCNYTPHYGSGVTPPENWPSKNYLAVIMTHDNEGPPSSKEIEG
VKKQVAGMQGVRLHFTDLEEYAKVLLAENPQVPTIRGDMVDPWIHGVMAMPQESKTARNI
RPLEPALDVLNTQLKGWGIPTTSLTEPLAKAYENSMLFSEHTFGAASPGYGAFSKDGKTQ
LSEAERYKYNEDFIKARKEGFYEKFESSFRDKAKYINTTDSIIGTNITARLNLLANHVRA
NKGDIVVYNPLPWMRSGVVDFNGGKIAVENIPANGYKIVKNTASRYTVSDASKTTLNTKF
YTVNFDTRKGGIVSLIEKSTGKELVDQHSNYALGQFLHERFSFAQTKDYHDRNYTRNNFA
AGLKPNLPKDISYLASTPTDWKMKVEQSPVADKVTLVTTNANPIAESVAITFTFPKASAY
VDVEWNVTNKIPNTVPDGGWLCFPFNVNKPKYIVGRLGGAIDLAKDQIVGGNRYLYGVQS
GASLVAPDQSGVGICPIDAPLLSFGEPGLWKYDYDYFPKQPSVFVNLYNNMWNTNFPYWT
EGSWSERVRIWGIKKGEKATENLAIQSWEARTPLMAVAATGKGTKLPSQQTGISVSRKGI
LVTAFGEDPDGNKGALLRLWEQGGVSGNTTVTLPKGSHYTKAIPVNLRGEISGKQLSVSN
GKLTFFLHNYAPASFILQ
Download sequence
Identical sequences A0A1W2C1D5
WP_084288813.1.84050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]