SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_084532436.1.83811 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_084532436.1.83811
Domain Number 1 Region: 677-1155
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.96e-27
Family alpha-mannosidase, C-terminal domain 0.039
Further Details:      
 
Domain Number 2 Region: 270-477
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6e-18
Family alpha-mannosidase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_084532436.1.83811
Sequence length 1156
Comment hypothetical protein [Arenibacter palladensis]; AA=GCF_900129275.1; RF=na; TAX=237373; STAX=237373; NAME=Arenibacter palladensis; strain=DSM 17539; AL=Scaffold; RT=Major
Sequence
MNLNQMLAAKIWLFIIFNCTAIYGQRSPKANETFLSGYQEKVTGNELQYPSGIEGLTSTL
ISRVDAGNQKMEWSTAPVSLKKKDGEVTFVHYVGYYANRPGSVFNFYVDGEKQTEIALPG
LDKTSWTLALKNDQKLSFEKIHEDNNHGYFGYLYYTVPAKNLKSGNSLKLGLTGNNEESQ
TYFMVFKRNLSESIKVTALPALIRSTDNKKYQTLLTEIISFREPVKAQLSIDGKLDRIVD
LEPGIQTLKISYPEVYKEKTITLKLDAGKEPMITKIRLKPVKKWKVNFVQHSHTDIGYTR
SQTEILAEHPRYIDYALDYCDATDDYPEESKFRWTCEASWAVDEFLNSRSQTQIDRLKQR
IKEGRIEVTGMYFNFNELPDEQSLAASLAPIKNISDKGIKITSAMQNDVNGIAWCMNDYF
NSLDIKYLTMGTHGHKALISFDTPLAFWWVSPSGNKMLTFRAEHYMQGNTFGVHTDNFED
FEKGLLNYLIKLDERGYPYDITAIQHSGFMTDNSPPSIKSSGLIKKWNEKYEWPKIKTAI
ASDFFEEFENKNGKELIEVKAHWPDWWTDGFASGAREVAATRNAHVDLIAGQGGLAMAKL
LGSKMPKGIKGRVFEANKALLFYGEHTFGAQESVSQPYSKATMEQREIKESYAWEASRRA
SMIGEEAIGLLSEYMGKTKNPSLAVFNTLNWEREGLVEIFIDHQQVVPGSKIRLVDEQGK
KYPVQVLKPWHGGTYWGAWVENIPAFGYKKFDIEVYKEQHSHSHGDEMHRHGEQEKNLNY
QEKQDHILLDNPWYSIKIDKLKGTISQIYDKDLAKNIIDEKSEYSLGEFILEKIGGRAQL
FTNRTANGESNGPLTDYTRQPLDSVWLSEIREGEIWNTIKFRGKTETAYDHSDAFSLELK
VYNTTKRIDFDFELKKKPITNPESFYISFPFELEKGKIHFEISGGPMEAGVDQVPGSAND
WNTVQNFVQIKNDKEQIVLVSPEAPIMQFGAINTGRFEYKGVPQSNNLYSWPMNNYWTTN
FNADQRGMYTWTYQLTSMDKNSDKEATKFGWGSRVPFLARVIPASVLEKKATNTLSILSN
IPDNILIVNATPLEDENGIILHLREVSGKESSFIPEIFSGKTIKYFETNVIGDEIKETSK
LNMKALESKFFKLSWE
Download sequence
Identical sequences A0A1M4SWU4
WP_084532436.1.83811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]