SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_084812022.1.93640 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_084812022.1.93640
Domain Number 1 Region: 655-1068
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.89e-24
Family alpha-mannosidase, C-terminal domain 0.051
Further Details:      
 
Domain Number 2 Region: 271-569
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000217
Family alpha-mannosidase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_084812022.1.93640
Sequence length 1098
Comment hypothetical protein [Flammeovirga pacifica]; AA=GCF_000807855.2; RF=representative genome; TAX=915059; STAX=915059; NAME=Flammeovirga pacifica; strain=WPAGA1; AL=Scaffold; RT=Major
Sequence
MKLKTFTFSFILLQLILISNLSAQDSKFLKGFTKYVHGDIMPYKSPQEDANQTMLVRCEN
GKEVMEWEAESVPKNYNGKFVEFGLIMGVDIDRAQYSYDIYINDKKYFTFTAPEESILQD
VIADGPNESNLTFKGTMIDAYSDLFGYAFLKVKTEDLPKGEPIKMKIVAPNVGKSSWMMV
FRYGLDGNVSWKQEPAVINTKKGPKQLLRTTILHYGDPTSATIIAGKEKQKVKLNVGANI
FRIEVDKVTETKDVPVKVLAGKKVLDDRILKVDPVKHYDLYLLHHSHVDIGYTHTQDEVE
KVQWKNLDDAVMMSQKTKDYPEYSKFKWSVEVMWAVESYLKNASLEKRAAFIEAVQNGSI
ELDGLYGNMLTGLSNPQELVESTFDALEISKEAGVPLESAMITDVPGYTWGIVPVLAHSG
VKYLSAGTNVFHRIGSTISTWGDRPFYWSSPSGEEKVLVWVHEKGYSHFHTGLGFKDLKV
LLTPKSVFDYLNELNDRNYPYDITTLRYTVGSDNGPVDQGISESVKQWNEKYETPKVILS
NTTESFKAFENKYGDEIPVVKGDFTPYWEDGAGSTSKETALVRNASEKLSQAMTLLSMND
VEIPNKEFEQAWRYVLLYNEHTWGAYNSISEPEADFVHSQWAVKQSFAIKADSIADAILA
KALASTKDEKGVTLTNTLSWDRANLIKLSAEQSSQGDIVLNRQGDVLPTQRLASGELAVW
INHMPGFGSKEIFVTPGDASSTKKVINHENGFENDQVKVEIDPNTGAIISLYDKITKQDL
ADTKSLKGLNDYYYVKGRNPKSPLTTSDDITIKYIEKGDLTSTIEISSSAPGTEEWKRLI
SINAYSNEVMIDNIINKTNIYDPEGVHIAFPFNVERGTVRIDVPFGEYIPEKEQLAGSCK
NYFTVQRYVDVSNLDYGITWASPDAPMIELGEITTDALSYGWVNEVKPTQTIYAYLMNNY
WETNYKASQDGWHDFRFVLKPHGTYVSSKAKKFSTSISQPILISENGNNEFIPLVRPKSD
QMIITAARPMKDNQVLITVLNASAGDNILSLEESKQVKEIRMSNIHGEDLGTYIPNENIP
GWGIRFLLVEKEPVKESK
Download sequence
Identical sequences WP_084812022.1.93640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]