SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_084958819.1.12103 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_084958819.1.12103
Domain Number 1 Region: 108-299
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.2e-21
Family 4-alpha-glucanotransferase, N-terminal domain 0.038
Further Details:      
 
Domain Number 2 Region: 534-951
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.69e-21
Family alpha-mannosidase, C-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_084958819.1.12103
Sequence length 1000
Comment hypothetical protein [Thermoactinospora rubra]; AA=GCF_002093975.1; RF=representative genome; TAX=1088767; STAX=1088767; NAME=Thermoactinospora rubra; strain=YIM 77501; AL=Scaffold; RT=Major
Sequence
MTSRLLQPSLGSPDYDGIRQALRHDTSTPVISVRGLEVRVSVLPLFTHDGRQAVRVTATG
MVPDGLVFRLGDQEGTGDFLVPEVSEPRPMTLEARDSHGVIATAEITVTPQRKWTVFVVH
HSHLDIGYTDPQGTVLRHHLDYLDAALRLTEETGAWPDDARFRWTVESSMPVLRWLAARP
REQADAFAERVRQGLIEVTALPFQLHTEACSTEELYRQLRFAERFPFPVRSAMHTDVPGA
VVGLVDALNAAGVRYLAAAHNWAGRSVPYLHGGDTLTRPFRWRAPSGNELVVWFTDTPHG
MAYMEGNTVGLTDSYELAEDLLPRYLFALASRPYPYGPGTFGWLGPDAPKDPYELDVLHL
RVQGAHADNAGPSIVPASVVRRWNETWAYPRLRSAVNSDFFDHVVERYHDRLAVHEGDWT
DWWADGLGSGARPLGYVRRAQSALRAAETLHTLAGQDATALVDEAYDKVALFNEHTWGAA
NPWEDAEEAGDSGGLQWTRKSAGAYQAQDDAADLLHAAVRHFAARLEGPEDSLASFAVFN
PGTWARTDVVRAFLPRDVVPLDAPVALVDARTGRRVPHHEEIVRPEDWPTRPIGRHLEAV
VADVPGLGYARLDVVPGDAAAAEPVDLGLEPVIENEFYRVTYDLREGYISSVFDKRAGRE
LVNADAAAGFGQYVYDRYATAPHFNHMSGHVGAHDRTLLGDRAIARRAAVVKATRTAVGE
KLVVELQAKGADWVRTTIELHAGVPRLDLRYQIAKQGTPAKEAVFLAFPFATAGPPAAWE
LTGGVGGTHVPRVPGSASYMLPIRHWLAFEDPELTIAWATLEAPLVQLGTIHMPYAPFPP
TLEEEHGTVYSWALNNIWDTNFPAQQQGETTFRYAVTSAPGAAGIGARRLGAAAAAGLTD
PFIGILTRCPASESFVSVDHPDVRVTSLGRFDGGTVVRLRSLAAEPVEVAVRLPGLRSAQ
VSAGLTGGRATAPVADETVKVRIPACGVAAVWGTCDAGNS
Download sequence
Identical sequences WP_084958819.1.12103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]