SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_086549221.1.52598 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_086549221.1.52598
Domain Number 1 Region: 668-930,981-1078
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.85e-25
Family alpha-mannosidase, C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 282-427
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000145
Family 4-alpha-glucanotransferase, N-terminal domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_086549221.1.52598
Sequence length 1102
Comment glycoside hydrolase [Sphingobacteriaceae bacterium GW460-11-11-14-LB5]; AA=GCF_002151545.1; RF=na; TAX=1986952; STAX=1986952; NAME=Sphingobacteriaceae bacterium GW460-11-11-14-LB5; strain=GW460-11-11-14-LB5; AL=Complete Genome; RT=Major
Sequence
MLLLIITLFAQTALAQKEVPYFGKINWINGFAKEISGENITYFSAFPDYATSALLTRATD
GKKTIEWETAKIPQNSKGDYVYFSWVAAHSTATSSGNRNFDLYVNDQKLLTFTTLPGNKT
PDWISKAEDGSALVFQQTKRDGANDAHGLAFLRLPASKVKPGQAIRIKVIGQAQNSNDWY
MTFKFSFEEKVDINPMPFLLKNGKQPIVLTALHFGKDEQLKVKVNNSESYAFVIKDGVNN
FDIPVNAVKKDDSVRILAVSAGKTLVNKFIAVKPVVYRELNFIHHSHTDIGYSHLQPEVL
KIHLKNIDDALAMIEKTKDYPVEAKFKWNIESLWAVENYLKQASPTQKEKFVKAVKEGSI
CLSALYANILTGLSQPEEMFHYTDYAAQLRKEFGFEINSAMISDIPGFAWSTVTALSKGG
VKYFSSGPNFMGEDHPYLGDRAGYFVKAWGDKPVWWTSPSGEEKVLFWTGAKGYSSWHGT
AIGGVFDRGPKKIAAYLQELTAKNYPYETVQWRYNIVADNGPIDTGVSDFVKQWNEKYAS
PKIVLNTTEKLFETFEKRYGAQIPTVKGDISPYWEDGAVSTASEEGKNRTNSLHLQQLTT
LYSMLNAKQYNAQQFYEAWTNIIMFHEHTWGAHNSITEPDVPFVTEQWRIKKQFMLDGDA
QINNLEENLLQPLTDSKSKKIAVFNTSSWKRTGPVVLSGTIAGRSVKDAAGNKKPLQKLS
NGNYVFMADVPALGTATYEISNDAPSSSASQFTVAENSISNGKIGFTWDKINGSITGLKT
ENNFNYVGGFSNQGLNSYWYVPGMNPQEAVSNGKVQVKVMENGPVLTKVSIISDAPGANK
LERTLSLFAGSDALLIENILDKKSVRSKEAVHFGYPFDAALTETTIDAGYGTMRYLKDQL
PGSNMDYLYGRRWLDVSKADKGIQWMLLEMPLIEPGNMIDERQTMPPKHKEWKKEGQPTS
TWFSYVMNNYWHTNYKADQEGAVHFKYALRPHNMVNDVEMEKAAAEFTQPLIAVPVKKEQ
TLPATLFELSNPKIVVTSITPNADGTYVVRLFNPEQAVQQTQFVWKSLQPKSFIEMKSGE
NRSATTKVNMAAMGVSEFLLIK
Download sequence
Identical sequences A0A1X9ZC88
WP_086549221.1.52598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]