SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_086984190.1.8955 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_086984190.1.8955
Domain Number 1 Region: 656-935,975-1060
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.04e-31
Family alpha-mannosidase, C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 272-555
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000834
Family 4-alpha-glucanotransferase, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_086984190.1.8955
Sequence length 1096
Comment glycoside hydrolase [Elizabethkingia anophelis]; AA=GCF_900156995.1; RF=na; TAX=1117645; STAX=1117645; NAME=Elizabethkingia anophelis; AL=Scaffold; RT=Major
Sequence
MTGNFIHAQKKVPYFGNINVINGYENEIIGENIDYFSAFPDHATRALLTRTTDGEKTIEW
ETAKVPQKNSGPYVYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQRPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPVNKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDANVTPFILKDGKRLITLTTLHFGPEEKITAKIDNKESFSFTMPDGIKTFDIPVML
SQTGGNIQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKDGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGDKLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
RLYNSQTFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLEGNSITNQLEK
DLLQPLTNPGSKKIEVFNTSSWARSGVVTIPATADGNSVQDAAGNKIPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLATTPFVVTNNSISNGKITLTWDNKTGSITHFTDNGTTNYA
GSYNNQGLNSYWYVPGSDPKEAKSNTEVQTKILENGPVMVKVLLTAEAPGANKLERIITL
YNDSDEALLENIVDKKPVRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDIGTTGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDSFNSVENEKYAAAFTQPLIAIPVNEKAEIKGSL
FHMKNDKIVVTSITPQDDQSFIIRLYNPDEKEQTTTFTWERLKPSKLIYNKTGKEISIND
SISLNSMDVIEIKVIP
Download sequence
Identical sequences WP_086984190.1.8955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]