SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_087329547.1.49220 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_087329547.1.49220
Domain Number 1 Region: 529-940
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.99e-30
Family alpha-mannosidase, C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 120-322,351-433
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.97e-21
Family 4-alpha-glucanotransferase, N-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_087329547.1.49220
Sequence length 966
Comment hypothetical protein [Parabacteroides sp. An277]; AA=GCF_002159645.1; RF=na; TAX=1965619; STAX=1965619; NAME=Parabacteroides sp. An277; strain=An277; AL=Contig; RT=Major
Sequence
MKTAIIIVGMLLGGIYTSQGATNPDLLQVKIHDFYKYRPDGKAGRSIKLVYQGDKKLENA
KVEIFSKKGNETFPIAVNATPDSIPVLLAPAIGVEQTDTIVASLVIGNERLSQEVIVPSM
RHWTVYIYPHSHVDIGYTNTQENVEFIHKRNLDVAMDLAEKTANYPEDARFRWNPEVVWP
VERYLNSESPEKKKRLLKAIKDGTISVDAGYVSTNTSASSDEELLQLFHWGKKIEKETGK
PVRTMVQTDIPGMSWGVVTAANELGIDYVLSLFNGSDRTGWTHELSFHPFWWIGPDGKSK
VLFLQPGAYTPGALAKGKYFWPKLAGQIDRSKLFPVVQTEHPRENFVDAYLAEMLPKLEK
DKEYPYDIFPMTWCMADNTPIDVDLPDAVKSWNEEYAYPHLKICTATEIMEAFDERWGDQ
LPTLQGDFTEYWTDGLGSSAEKTGESREVKERLVQSEILWSMLHPSEEEPEEMVQEAWRN
MILSTEHTWAFMDPQRQPIQDNILKTKLGYFDTARALTDQLREMTYEDIEDKNSDQLSVF
NTDLWVKSGLVTLPKELADKYGSLCDENGREVVCQRLTTGELVFFAEDVPALGYKNYQLK
QGSASQDHAFATTSPTQLDNGIVQVKVDPLSGDIISLLYQDEEFVDQEALVALNSYRYLK
GGDTSGRAYKPTNVRISIGEQGPLVNSLLIESDAKGCNSLRREVRLVKGSAVVEFNNLVD
KQAITEKEGIHFGFAFNVPQSTVRVNIPWGVMELEKEQLKAGNRNWIALQRWLDVSNEEK
GVTWCSLNACSFESGDLTANIIGGAYESPLWIRKLQPSSTIYSWALNNHWHTNFRLFQDG
KIEFKYRVWPHVGDYDVVSSNQFAMEQYRPMVAVQTKKNFKVKNSLSVNASDKIVLSNYK
TVNEGKNSIVRLFSLSDQDEQVSLSWSKKQPKSIVYIQNGKEVKLSDIKESFFVPAKGAL
SVWINW
Download sequence
Identical sequences A0A1Y4D4K2
WP_087329547.1.49220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]