SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_087404796.1.68577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_087404796.1.68577
Domain Number 1 Region: 123-207
Classification Level Classification E-value
Superfamily PKD domain 5.36e-21
Family PKD domain 0.0028
Further Details:      
 
Domain Number 2 Region: 209-387,444-582
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000000353
Family Quinoprotein alcohol dehydrogenase-like 0.0028
Further Details:      
 
Domain Number 3 Region: 47-120
Classification Level Classification E-value
Superfamily PKD domain 0.00000000209
Family PKD domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_087404796.1.68577
Sequence length 619
Comment hypothetical protein [Alistipes sp. An54]; AA=GCF_002159375.1; RF=na; TAX=1965645; STAX=1965645; NAME=Alistipes sp. An54; strain=An54; AL=Contig; RT=Major
Sequence
MKRIIFLLSVVSLLAPGACSESNDDMNTVYDSVINTDFTLPEGEIVAGITPVTFTNTTTV
EGTTVTDYFWHFGFAGEGNWSEEAQPDPVVYKTAGEYTVTLTAWGADGNRATVKKIIKVL
ADNVLPTADFAYAPMMVNVGDEVTFTDRSTDSDGQIVSRKWTLPDGSTSTAESPSYTFTS
AGMFRVTLTVTDDRGGESSVTKSVNVRSGDVADFTLLWSTAVASAEALCTANVVTVSDLG
YIYAVTGDGKLVALDANGDVAWEYDAAAQDQVSLTQEIAYASVDSDGTLYWAAHAYGTDP
VPTVYAFDGATGTVRWKNQTAYASGARIAYSTPCITPSLMVVGSRGTNGAIRGFDKASGQ
NTAHATPANGGATSGTVILKNGVVVFTNTSEYGYGIMVPDDQFVWSPVPTSNTFAPSKTL
SAGRCQPCVGADNCVYLPGKIKEGSGGTWNLAAFDCTNLTASSAKTPKWSAALDGGFEQT
GASLSADGQTLYIVADAVTPSVVYALNTTNGATRWSYTLDAQSRSIPAVDNLGQVHVVTL
SGHYVVLSAEGEVVCNEQIADSFEGSVSIAEWGYAYVLGKDTTAGKLKVYAVALPGVNSA
ADSAWSQYGRNARHINYQK
Download sequence
Identical sequences A0A1Y3WUI7
WP_087404796.1.68577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]