SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_088450823.1.23862 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_088450823.1.23862
Domain Number 1 Region: 253-346
Classification Level Classification E-value
Superfamily PKD domain 0.0000000131
Family PKD domain 0.0091
Further Details:      
 
Domain Number 2 Region: 313-432
Classification Level Classification E-value
Superfamily PKD domain 0.00000432
Family PKD domain 0.013
Further Details:      
 
Domain Number 3 Region: 430-554,616-649
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000196
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 
Domain Number 4 Region: 154-242
Classification Level Classification E-value
Superfamily PKD domain 0.0000373
Family PKD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_088450823.1.23862
Sequence length 765
Comment hypothetical protein [Roseateles terrae]; AA=GCF_002205615.1; RF=na; TAX=431060; STAX=431060; NAME=Roseateles terrae; strain=CCUG 52222; AL=Contig; RT=Major
Sequence
MQRFLGKAHRALLSSFVLLALSACGGGGGSDAPNQPPKVAVLSSGDVRANATGDSVGASL
GGLVRLDAGSSVDPDKDALTYSWALTSKPAGSTLVIADAAVQVLEFHPDVLGSYVFSLKV
IDARNGQATQQVRVVADNTPPTPGTVVQVTPVVMQAAPSTITTSVGYVVQLDSSSASDPE
GPIASRAWTLVSRPDASTATLSSTAATTTALSPDVLGDYVIKLAVTDAAGAKSEKLTTIR
ANNRAPTAAIASNATPVALPTAPGFKVPVGTIVTFRGDSSVDADGDTLTYLWSLDSRPSG
SSATLSSLSTATPSITPDVQGNYVFRLRVTDTSGAFSERSVTMMVGNDAPVVVLDHTRVT
VEIGGTVLATAALSYDGDGDPLTYQWQLDARPAGSTATIANAATPALSLVPDVVGVYQAT
VSVSDGRATVQRAVEIRALASIASQVPLGFTPGEARYDSSLDKIVVTSQSPTALRLVDPF
TGVTQSVVLPAPVKNYSLSPNGLLAVVLHEGMASLVDLQTMTLVRTFTTFGAQTDAFVDD
GGFVSLIGGDQWVRPAVTMINGRTGDVVDTSSGYFGTFYGTQYGVIAGKLNKVFVLSQGL
SPADISYYDFDPVAHKITGAGESPYHGEFAMATPMFLSEVQDLLFTASATFYRTSDLRYL
GRLSGVTRGVYSLTNNTALDETLALEPATGASYQGVNYTWTYASVYKRFTTSLQLPQPDL
SLPMIGGVQSYGVKVFHSATGRHVLLVQTGSATPGAGTGYYVITR
Download sequence
Identical sequences A0A246J3D3
WP_088450823.1.23862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]