SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_089014977.1.82220 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089014977.1.82220
Domain Number 1 Region: 299-575
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.78e-20
Family alpha-mannosidase 0.015
Further Details:      
 
Domain Number 2 Region: 692-1160
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000119
Family alpha-mannosidase, C-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_089014977.1.82220
Sequence length 1164
Comment hypothetical protein [Micromonospora inositola]; AA=GCF_900090285.1; RF=representative genome; TAX=47865; STAX=47865; NAME=Micromonospora inositola; strain=DSM 43819; AL=Chromosome; RT=Major
Sequence
MSIRLWQIGDPAAGPRQFADHWYAGTDARPSPYSPVDRPDPVERGPIFEIGRSDASTHWP
AVQPGPLDAGHGWRPADATIRFDAPAGSEELWHDLHLHALASHGPCPDLIVTVNGRRGLV
LLDPVRDDRAHAPMPPSPISGPIDRVVPLRPGLIRAGRNEIILTTHCLEEVEPDLTKTRP
HLPHLGVWFGSALSWRGLSLAAGTTPAEPTLRLCPTSLYVERDGDLFELVDLDLTSPHGF
AAGTAALRVGSHERSSPVEGVDFGDTRIRFAVPARSDTDTHTETEIDAHATLDLDGRRVE
LPRAPFRPARRWTLHLIPHVHLDVGYTDNQAKVIELHNRNIDRVTGILRRTPDYAFTVDG
SMILETFLRSRTEAPTTAALEAIRAGQVGVNAFYALFLAGVASLEECYRAAYLAAQLGRD
LGLPIRTANLTDVPSYPQAIPSIVAALGLTGFFGIANHTRGGNPDSDTLHLLSPVRWRGP
DGAEVVAYFSDSYSQLRFMCADPPSLAGMSASLPRYAARYDRPDYAPHDLPIVGTHADNE
DVADGYADLVGRWNARYAYPRLRFSTIADYLDAIRPLADRLPVLEGDGGSYWEDGIGTQA
AAIARYRRAQALMPAAEAMSALVAAADPTVRPDVSTLDEGWRRLLLGCEHTWTAAHATIR
PHSPDVIDQRDWKIGQIDEGLRIATDEARRAMSQLAELVPTEGPALVVANPASFARNVEI
EVELAADERVETLDGTALPAIRLGSAPGVVRVRTGPLPGFGYATYAVRRHTAPSREVTAR
PVPSSLDTPRYRVAFDPDTGRPTSLWHHRLDRELLDPTHGWALGDVLHVTGGGTASGRGL
GDEATSLNDIDPALPPPQLTVNAAAMRAEGARRLPWGWEISAVGAAPSLPVVRTTLRLHD
DTDRIDLTVTLVKEAELAKESVYVAFPFAVPDPIVRYDRQQGWVDPVRDHQPGACNEWFT
AQDAVTVAGPDLCVAWASADAPLFTLGDIVRGRWPRIATPSGMVLSWVMNNYWWTNTPAS
QDGTVILRYAFTPLSTYDPVAAWRLGRDLRAPVLTNLVTWLDKGASTPRRPAAGTLLDAA
LPSNVDASVFAGRRANGVVVRLRELAGTAATASVRHPHTGPGAVAMRCTATEEPVESLPV
RADGTVVVTLRPYEVVTVALKEPA
Download sequence
Identical sequences A0A1C5JWT4
WP_089014977.1.82220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]