SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_089028582.1.39393 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089028582.1.39393
Domain Number 1 Region: 661-935,975-1086
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.26e-33
Family alpha-mannosidase, C-terminal domain 0.037
Further Details:      
 
Domain Number 2 Region: 272-554
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000211
Family alpha-mannosidase 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_089028582.1.39393
Sequence length 1096
Comment glycoside hydrolase [Chryseobacterium sp. T16E-39]; AA=GCF_002216065.1; RF=na; TAX=2015076; STAX=2015076; NAME=Chryseobacterium sp. T16E-39; strain=T16E-39; AL=Complete Genome; RT=Major
Sequence
MTGNFVFSQKKTPYFGSIPTINGYAKEISGENIDYFSAFPDHATRALLTRTTDGAKAIEW
ETAPAPQKNNSPYVYFSWLVSHSSGSSGGIRHFDLYINDQKAVTLTTYPSNQHPDWISKA
TDSTAFVFHQTKMDGLKDSYGIAYLRVPSNKVTPGKPLRLKLVGQAQDSRDWFMTYKFTF
QEKMDASPTPFILKDGKRLITLTTLHFGAEEKITAKINNNDSFSFVMPDGIKTFDIPVEL
AQEGGNVQLTVTSGKKELLRKTIEAGAIVPRTLYFIHHSHTDVGYSHLQSEVERIHTQNI
YDALKMIGETQNLPEEARFKYNVEALWDVENFMRKATPEDKKSFVKAVKEGNIGLSAMYG
NILTGLSQPEELYHYTEYAKKLEKEYGLKINSAMMSDVPGFAWSLVPALTSSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGIHPGGVFE
NGQRKIAEYLDDLTKTNYPYDMVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGNQIPVVKGDISPHWEDGAMSTAKEEGINRNSSLKLQQLTTLYSMLNP
TQYDSQSFYEAWRNVILFHEHTWGAFNSITAPDLPFVKDQWQVKKQFSLDGSSLADKLET
NLLQPITNPASKTIAVFNTSSWVRTGPVTIPVTTLGNAIQDAAGHQIPLQRLEDGAMVFI
AKDIPPLGSASYTIVKAKPSSLKPFSVTNNSISNGKVTVTWDQKTGSITNFTDSSNINYA
GSFNNQGLNSYWYVPGSDPKEAQSNTEVQVKVLENGPNMVKISLISEAPGAKKLERILTL
FADSDEVGLENIVDKKPVRTKESVHFGFPFNAGFKNITVDAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASFGQKGMQWMVLEAPLIEASEMIDERMVIDNSHKKWKDNGTPGTTNWFSYA
MNNYWHTNYKSDQEGPVHYRYALRPHGSFNSVENEKYAAAFTHPLIAIPVNDKNFSGGSL
FRVSNDKIVVTSVTPQEDRSFIIRLYNPDEQEQSTTFAWEKLKPSQLIDVKTGKKITTNE
KISLSGMEVIEIKIIP
Download sequence
Identical sequences A0A220SD70
WP_089028582.1.39393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]