SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_089054992.1.8719 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089054992.1.8719
Domain Number 1 Region: 675-1082
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.55e-28
Family alpha-mannosidase, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 292-586
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000474
Family alpha-mannosidase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_089054992.1.8719
Sequence length 1114
Comment glycoside hydrolase [Flavobacterium oncorhynchi]; AA=GCF_002217355.1; RF=na; TAX=728056; STAX=728056; NAME=Flavobacterium oncorhynchi; strain=CCUG 59446; AL=Scaffold; RT=Major
Sequence
MNFKKQNISRLFLYFLLLFVTQSLFAQKEVPFFGKINWINGFGKEITGENITYNSAFQDY
ATVALLTRTTDGNKTIEWETAPVPKVIKDDYVYFSWVAGHSSGSSSGDRNFDLYVDGKKI
LTFTTLPKNQKTNWIFKTNDGSALAFQQIKLDGANDSQGYAFLRLPANKVKPGKAVRIKI
VGQKQNSNDWFMTFKFAFEENVKVTPMPFLLKDGTQTLALSVLHFGKDEIVNVKINEKEN
YTYIAKDGMNNFDIPIKAVTKDENVKVQVKLAGKTFIDNFFVVKPIVYREFHLLHHSHTD
IGYSHLQPEIVKVHNKNIDDALEMIEKTKSYPEEAKFKWNIESIWAVENYLKVATPTQKE
KFTAAVKNGDILLSALYVNMLTGMSQAEEMFHYTDYAAKLRKDFGFTINSAMISDVPGFA
WSTVTALSKGGVKYFSIGSNFMGLDHPYRGDRAGHFLKNWGDKPVWWTSPSGQEKVLFWA
GAKGYSSWHGMQPGDIYERGAKKIADYLNELTANNYPYDMVQWRFNIIADNAPIEPNASD
FVKKWNEKYASPKLILNTADKMFEAFEKKYGDKIPTVKGDLTPYWEDGALSTADEEGKNR
VNSLRLQQLTTLYTMLQPKKYDQQNFYEAWRNIIMFHEHTWGAHNSISDPDSHFVTEQWR
IKKQFMLDADTEINALEKNLFETISNSKSKKIAVFNTSSWKRTGLVLIETTVKGKSVKDA
SGKITPLQQLSNGKYAFIATDVPAFGTAFYEITDKTKSDFSNQFVLGDHSLSNGKIEFGW
DKNNGSITNLKTISDYNYAGDFNKQGLNSYWYVPGLNPEEVQTNTNVQVKTLESGPVVTS
VSIISDAPGANKLERIISLYSGSNQVLIHNILDKKAIRTKEGVHFGYPFNTQLTKTTLDA
GYGTIEFLKDQLAGSNMDFLYGRRWLDVSSGDKGVQWMLLESPLVEPNSMVDERKEVVPN
YKEWKKTEKPTSTWFSYVMNNYWHTNYKADQSGIVNFKYALRPHETTDRAVMEKEAAEFT
QPLIAMTVNEDVKLPVNLFELTNSRIVVTSLTPNQDGTILMRLFNPEQSEQETKFVWKSL
QPKAIIDKTTGAEKTKSTEINMTGSGVSEFILKI
Download sequence
Identical sequences WP_089054992.1.8719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]