SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_089314333.1.27536 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089314333.1.27536
Domain Number 1 Region: 565-1026
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1e-19
Family alpha-mannosidase, C-terminal domain 0.079
Further Details:      
 
Domain Number 2 Region: 119-315
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.06e-18
Family alpha-mannosidase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_089314333.1.27536
Sequence length 1028
Comment hypothetical protein [Actinomadura mexicana]; AA=GCF_900188105.1; RF=representative genome; TAX=134959; STAX=134959; NAME=Actinomadura mexicana; strain=DSM 44485; AL=Contig; RT=Major
Sequence
MTSRLLQASLGSPDYDGIRDALRQDTSTEVLAVRGLSVRAAVLPLFKRDETGALLQAVRL
ALSGERPVRAVLKDGDAEVASAAAEGGSVTLLVPEVDAPRRFTLEVRDSGGLVGAAPLDV
APQRKWNVFVVHHSHLDIGYTDTQGTVLRHHLDYLDAALRLARETDGRPDDARFRWSVES
SMPALRWLATRPDDQVAEFAERARAGDIEVTAFPMQLHTEACSTEELYRQLRFVEQLRRE
HGIEVRSAMHTDIPGAVVGTVDALNAAGVRYLAAAHNWAGRSVPYITGGDRLARPFRWRS
PGGGELIVWFTDTPHGMAYMEGNTVGLVDGYDLAEDLLPRYLGSLADRPYPYGPGTFGWY
AAPGQVGAAKDPDFLDAVHLRVQGAHADNAGPSIVPADIAHRWNETWAYPRLRMATNADF
FEYVEEHHGDRLQTHEGDWTDWWADGLGSGARPLGYVRRAQNVLRAAETLHALADERGGE
RTGASLSASRAIDEAYDRAALFDEHTWGAANPWEDAEEGGDSGGLQWTRKSQVGYQAHDD
ALDLLQAGARRIGATFGAAPDALASFLVVNPGTAARTDAARAFLPRDVVAVDVPIALVDA
RTGEPVPHREEEVDPDEWPTRPIGRHLEAVVPDVPGHGHVRVDVVRADTGAPEPVDLGFE
GTIENEFYRVVYDLREGHIGSVFDKTAGRELVNADAVAGFGQYVYDRYATAPHFNHMSGH
MLVHDKTMLGDRAVATHATVTECSRTPAGERLVVELHGKGVDWLRTTIDLYAGVPRVDVR
YQLGKQPTAAKEAVFFAFPFAVDGPPDAWELTGGVGGTGVPSVPGSAEHMRPIRHWVAFE
DPDLTVAWATLEAPLVQFGSIHMPYAPFPPTLDNEDGTVYSWALNNIWDTNFPSQQQGET
TFRYAFASGAAGSGRRLGARTAAGITDPFVATLATGDMPAAESGTFLRVDDPDVLVTSVG
RARDGDGLAVRLQSLAAGPVETGLHVPGATGALLSGGLERDPAELPVRDGTMTVRLPACG
VATVTVRR
Download sequence
Identical sequences A0A239BCG3
WP_089314333.1.27536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]