SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_089326319.1.88012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089326319.1.88012
Domain Number 1 Region: 575-1046
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.32e-21
Family 4-alpha-glucanotransferase, C-terminal domain 0.097
Further Details:      
 
Domain Number 2 Region: 133-329
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.17e-19
Family 4-alpha-glucanotransferase, N-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_089326319.1.88012
Sequence length 1048
Comment hypothetical protein [Actinomadura meyerae]; AA=GCF_900188445.1; RF=representative genome; TAX=240840; STAX=240840; NAME=Actinomadura meyerae; strain=DSM 44715; AL=Scaffold; RT=Major
Sequence
MTSRLLQASLGSPDYDGIRAALREDTSTEVLAVRGMSVRAAVLPLFKRGEDGTLRQAVRV
TLSGGEGEGESEGGGGGGGGSVEVALKDGDTELASATGDGGTLTLLVPEVDAPRRVTLEV
RDSAGLVGAAPLDLTPQRKWNVFVVHHSHLDIGYTDTQGTVLRHHLDYLDAALRLARETD
GRPDDARFRWSVESSMPALRWLATRSADQVAEFTDRVRAGNIEVTAFPMQLHTEACSTEE
LYRQLRFVEHLRRTYGIEVRSAMHTDIPGAVVGTVDALNAAGVRYLAAAHNWAGRSVPYI
TGGDKLARPFRWRSPGGGELIVWFTDTPHGMAYMEGNTVGLVDSYDLAEDLLPRYLGSLA
DRPYPYGPGTFGWYAAPGQVGAAKDPDFLDAVHLRVQGAHADNAGPSIVPADIAHRWNET
WAYPRLRMATNADFFEYVEEHHGDRLQTHEGDWTDWWADGLGSGARPLGYVRRAQNVLRS
AETLHALADERSGKRTGAAEEIDEAYDRAALFDEHTWGAANPWEDAEEGGDSGGLQWTRK
SQVGYQAHDDALDLLQAGARRLGATFGPAPDALASFLVVNPGTAARTDVARAFLPRDVVA
VDVPIALVDARTGEPVPHREEEVDPDEWPTRPIGRHLEAVLPDVPGHGHVRVDVVQADAV
RADVVQADAAATEPVDLGSDGTIENEFYRVTYDLKEGHIASVFDKAAGRELVNTDGIAGF
GQYIYDRYATAPHFNHMSGHMLVHDKTMLGDRAVATHATIAKCERTPAGERLVVELHGKG
VDWLRTTIDLYAGVPRVDVRYQLGKQPTAAKEAVFFSFPFAVEGPPAAWELTGGVGGTGV
PSVPGSAEHMRPIRHWVAFEDPDLTVAWATLEAPLVQFGSIHMPYAPFPPTLDNEDGTVY
SWALNNIWDTNFPSQQQGETTFRYAFASGAAGSGRRLGARTAAGLTDPFVATLATGTAPA
AASGTFLRVDDPDVLVTSVGRARDGDGLAVRLQSLAAAPVEAELHVPGTTSARLSGGSER
DPAELPVRDGTMTVRLPACGVATVTVRR
Download sequence
Identical sequences A0A239HVE5
WP_089326319.1.88012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]