SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_089708570.1.65246 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089708570.1.65246
Domain Number 1 Region: 529-934
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.57e-29
Family alpha-mannosidase, C-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 118-272
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000163
Family alpha-mannosidase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_089708570.1.65246
Sequence length 957
Comment glycoside hydrolase [Chitinophaga costaii]; AA=GCF_900094705.1; RF=representative genome; TAX=1335309; STAX=1335309; NAME=Chitinophaga costaii; strain=A37T2; AL=Contig; RT=Major
Sequence
MKINIFIGLAGCVLGGIPALAQQVFTGISLKATPAYLRYHDQPARMARLEFHGGNAYAPG
VVYISFNGLEDSVQILPGQEGLRYYELPLPGAPVEVETQASVKYMTNGNAYTARVLVPPA
RQWSVYLLPHAHVDVGYTNVQDKVLAIHMNNIDEAIKIAERTQDYPLEARFKWNTEAIWV
VDNYLAKASPAKKAAFWEAVKKGWINLDGSYGNVNTSATSPVQLLHQFQTSLQLAKENGV
EIHTMFQGDVPGASWGLSAQSDITGIHYFLSAPNASDRIGEADKLRDKPFYWVSPSGKQR
MLFWQSSPYSIGYMLKGDKIPNFFTVENPTPFYTGKPSENFLNPWLFGYLEDLRQKGFPY
NMTLLTWAMSDNAPIDPELPEAVKAWNERYTSPRLVITSTHQFFQDVEAAYHDKIPTVAG
DYTEYWTDGISSGAKETAITRNASDALQQAGAIWALRGRNDYPASDFNKAWIDMVMFNEH
TWGAYNSVSEPADPKVKAQWAYKQNFALQAQTRSSALLTASIAGDNALPNAVDVYNTLAY
TRTALVTVPAALSQGGNLVTDNHGHKLPSQRLSSGELVFLVTQQAPFSKQRYHISPGKAF
VKNRATVNGYTLKNDFYTVQVDAHTGNISSLQKAGSAANLADAGGLNQYDYLVGDSVGGL
KTAHDVRIRVKENGPLLVSLLVSAQADGTHQLTREVQLVAGVDRVAFINTIDKKATGDKE
SLHFVFPFHLPGAQVRYNIPWSSITAESDQLPFSNRNWYTLQRWVDVSDKDHGITWSSPD
APLFEIGQYPTAGLLGGLHNSPLWRTYTDQQPIIASWVMNNLWHTNFRYSQEGPVIFHYY
LHAHAAYNAAEVNETGLENHQPLVVAAATGAGAESLFFQLQSGNAYVENINPASDGNGVV
LQLVNAAESPTQVTFTARNKAVLHLWECDLLESNKKELGTRFHIPAKGVLMVRVGKQ
Download sequence
Identical sequences A0A1C3ZLT1
WP_089708570.1.65246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]