SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_089807916.1.13951 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089807916.1.13951
Domain Number 1 Region: 542-812,844-955
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.22e-29
Family alpha-mannosidase, C-terminal domain 0.021
Further Details:      
 
Domain Number 2 Region: 125-316
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000445
Family alpha-mannosidase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_089807916.1.13951
Sequence length 969
Comment glycoside hydrolase [Chitinophaga sp. YR627]; AA=GCF_900114995.1; RF=na; TAX=1881041; STAX=1881041; NAME=Chitinophaga sp. YR627; strain=YR627; AL=Contig; RT=Major
Sequence
MYIHIMNRLKRWYTDKYCVLLLAVMTVSAAHAQQTPAFTSIGLQPTVAYLKYQGRSARMV
RLLFHGGNSYAPAMAYMTFNGLYDSIPLTAAEKGISVFELPLPGAPVQHETQLYVKLTSG
GREYTARCMVAPAPEWKVYLLPHSHVDIGYTNVQEKVMKLHMNNIDEAIRIAERTQNYPP
DARYKWNTEAFWVVDHYLAAADETKKKAFWEAVKKGWIIIDGAYANINTSVTDSRQLMQM
FYTAVKTAKDHGLDITTMFQGDVPGASWGLASQSGITGIRYFWGAPNASDRIGQSPGWRD
RPFYWQSPGQQKMLYWQSEPYSIGYTLKGSKIPNFFTVEDPVPYYTGHPSENFLNPYLFS
YLAALDKKKFPYNMTIMTWAMSDNAPIDPELPEAVKAWNERYTSPRLVITSVKQFFTDFE
AAYADKIPVVSGDYTEFWTDGIASAARETGFNRNASETLQQADAVWALRGKADYPATAID
TIWNNILLFNEHTWGAYNSISNPDDPKAVSQWGYKQSFALKGHTQSAAMLTLATGGDAIA
NAIDVYNTIGEDRTELVLVSAAQSTAGDLVKDSNGKKVPSQRLSTGELAILVQHIAPYAK
QRFTILAGKAYSNTKSVVSNTTLQNDLYKITLNAATGTIEKLERSGIQHNLADSGGLNRY
SYLPGDSLQSIAYAGPATITIKEKGPLVVSVLVSAVAPGANALNTEITLVAGVDRVQIIN
TIDKKAITKKEGVHFGFPFNVADAQVRYSIPWGSINVEADQLQYANRNWYTVQHWVDVSN
KDYGVIWSTPDAPLFEVGAQTTADLTGGLYDSPKWISFTEQHPAIYSWVMNNLWHTNFRH
AQEGPTTFRYYLTVHHGYDAYAANQQGLANHRPLIAAPASGPATESLPFSIQSKSVYVES
LKPAADGKGVIVWLVNAAPVETSVSFRANNTTAKLRLTATNMLEEYKQSLDNTLTLPAKG
VMMIRVENK
Download sequence
Identical sequences A0A1I4XG69
WP_089807916.1.13951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]