SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_089833115.1.27650 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089833115.1.27650
Domain Number 1 Region: 535-798,837-949
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.51e-29
Family alpha-mannosidase, C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 119-309
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000000474
Family alpha-mannosidase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_089833115.1.27650
Sequence length 962
Comment glycoside hydrolase [Chitinophaga filiformis]; AA=GCF_900102545.1; RF=representative genome; TAX=104663; STAX=104663; NAME=Chitinophaga filiformis; strain=DSM 527; AL=Scaffold; RT=Major
Sequence
MTWNMTKYFLLLLLWCSIYTAAKAQDKEQVFTSIELKPTVAYLKYEGRAARMVRLLFHGG
KHYAAATAFISFNGLKDSVRINAGGKGMEVFELPLPGGPVQQETQLYVKLAADGREYTAR
CMVAPAPEWKVYLLPHSHVDIGYTNVQEKVMRLHMNNIDEAIKIAQRTQDYPADARYKWN
TEAFWVVDHYLAAADEAKKQAFWEAVKKGWINIDGAYANINTSVTDSRQLMQMFHTAVKT
AKEHGLTINTMFQGDIPGASWGLPSQSAITGIRYFWGAPNAGDRIGNSPKWRDRPFYWQS
PGGEKMLYWQSEPYSIGYTLKGSKIPNFFTIEDPVPYYTGKPSDNFLNPYLFDYLAALDR
KKFPYNMTIMTWAMSDNAPIDPELPDAVKEWNEKFASPRLIITSVKQFFGDFEAAYKDKI
PVVSGDYTEFWTDGIASAARETRYNRNASERLQQADAVWALRNKQGYPAKDFDTTWNNIL
LFNEHTWGAYNSTSNPEDPKAISQWEYKRSFALKGKEQSTMLLEKAAEGTAIPNAVDVYN
TIGDTRSGLVILSAAQSTAGDLVKDANGKNVPSQRLSTGELAVLVQQIAPFSKQRFTIHA
GKAFTNTKATVTTTTLQNGLYKVVLDEKTGDIVRLERTGIAPNIADSGGLNRYSYLPGDS
LEKIQYAGPAKISIKEKGPLVVSLLVESSAPGANALSREIRLTAGMDRVEIINTIDKKAI
STKEGIHFAFPFNVANAQVRYSIPWGSINVEADQLQYANRNWYTVQRWVDVSNKEYGITW
STPDAPLFEVGRQTSADMLGGLYDSPKWINFTEQHPALYSWVMNNLWHTNFRHAQEGPAT
FRYYLQVHHAYDAFAVNQSGLAVHRPLIAAPATGDASESLFFNIDSKAVYIESIKPADDG
KGVVLWLVNTSAAEAPVTFTAKDKTGGLNIWESNMLEEYKQQLNNKVTLPAKGIMMLRVE
KK
Download sequence
Identical sequences WP_089833115.1.27650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]