SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_089904306.1.17484 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089904306.1.17484
Domain Number 1 Region: 571-978
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.19e-32
Family alpha-mannosidase, C-terminal domain 0.0062
Further Details:      
 
Domain Number 2 Region: 145-338
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000571
Family alpha-mannosidase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_089904306.1.17484
Sequence length 1000
Comment glycoside hydrolase [Chitinophaga arvensicola]; AA=GCF_900110835.1; RF=representative genome; TAX=29529; STAX=29529; NAME=Chitinophaga arvensicola; strain=DSM 3695; AL=Scaffold; RT=Major
Sequence
MKHIIASLLLCSCLGSACALAQKAVIPASHSQSSPDTKTNRQRRTSAETNPANQSTSFTS
IELQPTVAYLRDHGAAARMVRIRFHGGSSYKAATVYTQFNGREDSTTLPASTAGMTDYEL
ALPGPPVEKDAQLFVRLVSDGQTYTARCIIAPARQWKVYLMPHSHVDVGYTNVQAKVLAI
HMNNIDEAIKIAARTANYPVEARFKWNTEALWVVDKYLSTASNEKKQAFKEAVQKGWINL
DGAYANTNTSATSSAQLLQLFSTGARLAKDYGMQIHTMFQGDVPGASWGLISQSNLTGVH
YFLSAPNANDRIGSSGQWRDKPFYWRDASGQQQVLFWQSSPYSIGYTLKGSKIPNFFTVE
DPKPYYTGKPSDNFLNPYLFDYLSQLEQKTFPYNMTLLTWAMSDNAPIDPELPDAVKAWN
ERYASPQLVITSVKQFFQDFETAWKDKIPVMSGDYTEYWTDGIASGARETAINRQASDRL
QQAGAIWAIRNKPGYPADSFHNTWLNLLMFNEHTWGAYNSVSEPQDPKAIAQWRYKQAFA
LNAQQQSIALLDSSTNGAANAAGDNAKEYTGNTANAVDVFNTLGQPHTAVVLIPAALSQA
GDQVKDSQGKKLPSQRLSTGELAFLATALPPFSKQRFTIHAGPQTTGTKATVTANSLDNG
LYTIRVDPNTGNITELRKKGYDGNLADAAGLNQYSYMPGDSAEKVVSSAQANIRIKEKGP
LVVSLLITTPAPGANSLTREIRLAAGSDQITLINTLDKKAIGDKESVHFVFPFHVPGAQV
RYSIPWGSIRAEADQLPYTNRNWYTQQRWVDVSNKNVGVTWSSPDAPLFEIGQYPTAGLL
GGLHNSPRWLAFTEQQPLISSWVMNNLWHTNFRRDQEGPTTFHYYLQVHGAYDAAVVNRA
GLEHHQPPVVTAASGPASERLFFDINGGPVYVENLYPAADGNGVLLQLVNSADHTATVTL
TSKNALSISESDLLETNKKTLSDSFEIPAKGILMIRVARK
Download sequence
Identical sequences WP_089904306.1.17484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]