SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_090103320.1.3322 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_090103320.1.3322
Domain Number 1 Region: 535-951
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.98e-24
Family alpha-mannosidase, C-terminal domain 0.034
Further Details:      
 
Domain Number 2 Region: 116-307
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000326
Family alpha-mannosidase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_090103320.1.3322
Sequence length 964
Comment glycoside hydrolase [Chitinophaga sp. CF118]; AA=GCF_900112615.1; RF=na; TAX=1884367; STAX=1884367; NAME=Chitinophaga sp. CF118; strain=CF118; AL=Scaffold; RT=Major
Sequence
MKTKVFKLLMYCCIPCLASHGQTNGQHAKPSFTSVELQPTVAYLKYKRTESRMVRLIFHG
GNSYSPGKVYISFNGLQDSLLIAASETGLSYYELPLPGAPVKEERQLSVRYQSNGQEYVA
RCIVAPTRQWSVYIMPHSHVDVGYTNIQEKVLAIHMNNIDEAIKIGQHSENYPAEARFKW
NTEAIWVVENYLARADDEKKRIFWDAVKKGWINLDGAYGNINTSATSPAQLMHMFATGTR
IAKEHGIEVNTMFQGDVPGSSWGLSSQADITGIKYFLSAPNASDRIGTADSWRDKPFYWS
SPSGNQKLLFYQSSPYSIGYALKGTKIPNFFTIEDPKPYFTGKPSENFLNPYLFGYLAKL
DQKSYPYNMTLLTWAMSDNAPIDPELPEAVKAWNEHYASPRLIITSTKQFFQDFETAYKD
KIPVIEGDYTEYWTDGIASAARETAINRNASDHLQQAGAIWAIRGKQDYPVAAFDKAWTN
IVMFNEHTWGAYNSVSQPEDPKAVSQWNYKQAFALNGKSQAEALLAESAKGTPVANAIDV
YNTLNTIHTGLVIIPTAQSSAGDLVTNSNGKKVLSQRLTSGELAILAEQIPPYSKRRFTI
QKGKAYEKGIVTVRGNSLQNGIYTIVLDTITGNIIQLQKAGNTHNLADSTGLNQYTYLPG
DSLEKIQYTGKATIIVKEKGPLVASLLVSSSAPGANKLTREIRLVAGLDNIELINTIDKT
AVPAKESVHFAFSFRVPAAQVRYSIPWAGINAEADQLKHANRNWYTMQRWVDVSNKDFGI
TWSSPDAPLFEIGKYTTVGLLGSLDDPKHWLNFTEQQPTISSWVMNNLWHTNFRRDQEGL
TTFRYYLQVHNAYNADDVNRYGLENHQQLVVMPAAGPAEESLFFNITAKNVYIENINPSR
DGKSVLLQLVNVQETPAAVTLTAKDKMASLNIWESTLLEENKSPLSTTFNIPAKDVMMIR
VAIK
Download sequence
Identical sequences WP_090103320.1.3322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]