SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_090258755.1.4353 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_090258755.1.4353
Domain Number 1 Region: 230-420
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.55e-31
Family Quinoprotein alcohol dehydrogenase-like 0.0028
Further Details:      
 
Domain Number 2 Region: 356-574
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.85e-25
Family Quinoprotein alcohol dehydrogenase-like 0.0019
Further Details:      
 
Domain Number 3 Region: 36-121
Classification Level Classification E-value
Superfamily PKD domain 3.92e-22
Family PKD domain 0.00061
Further Details:      
 
Domain Number 4 Region: 160-227
Classification Level Classification E-value
Superfamily PKD domain 3.53e-16
Family PKD domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_090258755.1.4353
Sequence length 594
Comment hypothetical protein [Fabibacter pacificus]; AA=GCF_900111145.1; RF=representative genome; TAX=1267423; STAX=1267423; NAME=Fabibacter pacificus; strain=CGMCC 1.12402; AL=Contig; RT=Major
Sequence
MQPNYKTMKTNLIMKKHLLLLVLGLIIVASCKKEDPENILPTASFSISSSAPETEETISF
TDLSTDSDGEIESWSWDFGNGSSSTEQNPSTIYTDPGKYTISLTVTDNRGGVGTKTQELD
VIDGNQIPNVAFGIAATSNIIETTDGLLYGETSTDSIFFKGMELNFTDNSSDDGTITSYS
WDFGDGTTSDATNPTHTYSEDAKTYEVTLSVTDDEGAVGTYTKKVYIAGLKWTFLTNSME
TASPSVDDNGDIYIGDRAGYVYKINKDNGTAIWTFEAGERVRSSVTISDDGQTVYVGSNA
EKFYAIDAATGAEKWSVDVTGQIDKSSAALDVDGNLYVGTGDGILYSFDASGNENWTFDG
GHEDGGIQSSPIYYNNMVFVAIDSMVYGVNASTGEKTWGYDTNGDRYEGHFVIDDNGYLY
GGSEENDENFGYLYALNTADGSEIWQRDVPGEVRANSPILGEDGGLYISTEDGDDQASMA
MYKLDAASGAQLWESTPAEDDFKVGGTLGATGTIYIGSNDDHFYLVDSETGGTMLKFRYE
DADHSTVPVIGTDGTVYFGNRGSFLYALSVFDNEALPVAGWPTVGGNAKHQDRK
Download sequence
Identical sequences WP_090258755.1.4353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]