SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_090533163.1.40179 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_090533163.1.40179
Domain Number 1 Region: 528-937
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.51e-33
Family alpha-mannosidase, C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 119-302
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000000274
Family alpha-mannosidase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_090533163.1.40179
Sequence length 960
Comment glycoside hydrolase [Mucilaginibacter sp. NFR10]; AA=GCF_900100445.1; RF=na; TAX=1566292; STAX=1566292; NAME=Mucilaginibacter sp. NFR10; strain=NFR10; AL=Scaffold; RT=Major
Sequence
MNKIFSILSAFIFICTSAMAQTGGKHFNGITLQPTIAYINYQGEPRRMVRLLFHEGKNCA
ATEATVSFNGITDHVIIPASKEGTDVFELPLPGSPITSAAQVTVILNSGGQTYMARCIVE
PARNNWTIYILPHSHVDIGYTNTQAKVLKLHMDNIDEAIDLAKKTANYPVEARYKWTTEA
IWVVDNYLKAADEAKKERFWDAVKKGWINLDGAYGNINTSMTDSYQLMQMFAKSQKLAKA
NGVEIHTMFQGDVPGASWGLAAQSEQTGIKYFLSGPNASDRIGNLAKWQDKPFYWISPSG
KQKLLFWQCQPYSIGYALKGTRIPNFFTIEDPKPFYTGHPSDNFLNPHLFQYLGGLEQNN
FPYNMSLLTWAMSDNAPIDPELPDAVKSWNEHFASPKLVITSVKQFFHDFEKQYQDKIPS
FTGDYTEYWTDGVSSAAKETAISRQTSDKLKQASALWAIRNKRAYPADDFDDTWKNLLLY
NEHTWGAYNSVDDPEDAKVKSEWTIKKGYALSAQKQTDSLSNLILAIKTAAANKVDVYNT
LSWPRTDVVYVPAGLSKAGDLVKDATGNAIPSQRLSSGELAFVAIGVPAFGKKTYTINRG
KAFAKGKAVISLNGLANGIYTVTIDSKTGDISKLVKIEGGKKQVLVDSTGFNKYIYMPGD
SLQRQQTSTDAIISIKEDGPLVVSLLVTSKAPGAYGLTREIKLVNGLDKIELINTIDKES
IRSKESVHFAFPFSVPGAQVRYSIPWGSAAAEADQLPNANKNWFTMQRWVDVSNAAFGIT
WSSPDAPLFEIGKITTADLLGGLHHAPQWLTFTAQSPKIYSWVMNNLWHTNFRAEQEKGP
ATFRYIFRSHALGYDSFDANRFGLNNHQPLVVSASDNQNDELFFNIGGKQIYVESLKPAD
DGNGVIAQIVSTGDSEVNITPKAKATIKIWKSNLAEEKVAALDNNFKIPAKGIITVRIEK
Download sequence
Identical sequences A0A1G4THL0
WP_090533163.1.40179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]