SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_091034790.1.40495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_091034790.1.40495
Domain Number 1 Region: 370-558
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.06e-24
Family alpha-mannosidase 0.031
Further Details:      
 
Domain Number 2 Region: 755-1036
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000816
Family alpha-mannosidase, C-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_091034790.1.40495
Sequence length 1255
Comment hypothetical protein [Glycomyces harbinensis]; AA=GCF_900101745.1; RF=representative genome; TAX=58114; STAX=58114; NAME=Glycomyces harbinensis; strain=CGMCC 4.3516; AL=Scaffold; RT=Major
Sequence
MPEVIEFPIGGADLPAFQPGPLDAEAGWRDHRVELRTAVPSEGHGPEGHWLLRLEFDAGH
GPCPDLLIDLDGERTGLFHPEVVREDRAEVYRHGPIAGSAILEVPLGPLAAGRHAIGLTT
TLDTAAATGPVADPGGPTRHREQFGHHFGSGITWRRLALVSYDAAEANGVPTAPATEPGA
PIGTATEVPTAPATRAASGAPSASAPGAPTAAHVDLRSTPLFIESEGLQQLIDLTVTVPI
GTEPPRTAEVRIGDRTWTHGLTRPGRDFGQFRVRFPVPELAGPTETEVRLGSVDPNAAGS
GGVDSGDAAGNRVANGGGGFEVAATDGTGADDAGFSDVAASPAANGATGGGTAATDRVRS
FSREPVAFILEPKRKWTVHLIPHVHLDVGYTDVQGKVLELHSRNLDRALAALDRNADFAF
SVDGSLIVAQYLATRSPERSERVLAALRSGRVSVNAFHSLFLSGVASLEEVYRAAYLAAR
LREDHGVPVDYANLTDVPSYSAAVPSMLRALGIDAFVGIENHHRGGNADSDLQHLASPVM
WEGVDGSRVLAHFSDTYSQLRFMAGDPQTLPGGAHALDRFLARYERDDYLPHDLPVIGTH
ADNEDLADGDAAFAARWNAAYAWPRIAVSTMAGYLDAVRPLADRLPVWRGDGGSYWEDGV
GTGATVAAEHRRTQTALPVAEALTALVARADDTYRPNRAALDAAWEGALFGCEHTWTWSH
ANAHPHGEQVGDQLDWKRHQVHTGHRNAVDETRRALSQLGELVTTDGPTVLAHNPLGWAR
DVEIEVEAPAGTPFLLNGAPLPTEALADCDGLVRHRLTVPDVPPFGYRTVPMGSARTLAP
GEEGGQAERAAAAGDDWRPVPETLTTDRWELALAPDTGAVRSLTHRPTGRTLLDTSSAWH
LGDVLYVLNGPDTLTRGDHPDAFTHSGAPHTHPHPPRSTLSGRRPIADPPELTVTAAAMR
PVGLRRTYDGWRLRTVGTAPNLPHVEVDLLLRDGDDRVDVLVRLEKKRELAKEAVYVAFP
FAAEDPRLAYDRQQGWIDPATDHAPGACHEWFTTQYGVTVSSGPGGPAVVWTSADAPLFT
AGDIVRGAWPEQFHIPNGSIFSWVMNNYWPTNTPPEQDGTLELRYAFTPMPAFDAAAAGR
FGREVRFPGVPGEVNRLDKFDTEPRPLPADAASLLDLDLPPEVHATVAEPRDRRGLLVRF
QDLSGRGTRVPLPTTGTAVRCTADETPLEPLLDATVTLRPWEVVSILLHENGDAR
Download sequence
Identical sequences A0A1G6WX07
WP_091034790.1.40495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]