SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_091081273.1.74246 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_091081273.1.74246
Domain Number 1 Region: 107-299
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.11e-19
Family 4-alpha-glucanotransferase, N-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 527-818
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000926
Family alpha-mannosidase, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_091081273.1.74246
Sequence length 968
Comment hypothetical protein [Nonomuraea wenchangensis]; AA=GCF_900111685.1; RF=na; TAX=568860; STAX=568860; NAME=Nonomuraea wenchangensis; strain=CGMCC 4.5598; AL=Scaffold; RT=Major
Sequence
MTSRLLQRSLGSPDYDGIRQALRDDTSTPVISERGLEVRVAVVPLFTHDGRQAVRVSSTV
PLTHVLVGVDSATGTDVTLLVPEVDAPRALTLECRDESGVVGTARVTVTPQRKWSVFVVH
HSHLDIGYTDPQGTVLRHHLDYLDAAVRLAEETASWPDDAKFRWTVESSWPAQKWLAARP
AEAVESFRRFAREGVIEVTALPFQLHTEACSTEELHRQLRFARESGLPVTSAMHTDVPGA
VVGLVDALSAAGVRYLAAAHNWAGRSVPYLHGGDKLTRPFRWRAPSGNEILVWFTDTPHG
MAYMEGNTVGLTDSYELADDLLPRYLAALASRGYPYGPGTFGWQGPDAPREPYELDVLHL
RVQGAHADNAGPSIVPASIARRWNEQWAWPRLRSAVNSDFFAHVEEHHLDRLAVHEGDWT
DWWADGLGSGARPLGYVRRAQSALRVAETLHTLAGVDVTAQVDAAYDGVALFNEHTWGAA
NPWEDAEEAGDSGGLQWTRKSSGAYQAQDDAADLLHAGVRRFAAALAEGEGRPAFAVFNP
ATRARTDVVRAFLPRDVVPVDVPIALVDARTGETVPHHEEFVDPDDWPTRPIGRHVHAVV
RDVPGFGHVRLDVVRAQAQPPEPAEPSRDAVIENEFYRVAYDVREGHISSVFDKRAGREL
VNGEAAAGFGQYVYDQYATAPHFNHLSGHVGAHDRTLLGDRAIGRHATVTECRRTAVGER
LVVELRGKGVDWIRTTIELHYGVPRLDLTYQLAKQGTPAKEAVFLAFPFAAGPPSAWELT
GGVGGPDVPQVPGSAAYMLPIRHWIAFEDPELTVAWATLEAPLVQLGTIHMPYAPFPPTL
DQEDGTVYSWALNNIWDTNFPAQQQGETTFRYAVASEPGVPARRLGAAAAAGLTEPFVGA
LVTDAAPAVTTYASVDHPDVLITSIGQNGVRLQSLAAEPVEATVGLGNETTTVRLPACGV
AVAEGTRL
Download sequence
Identical sequences A0A1I0HG37
WP_091081273.1.74246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]