SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_091169996.1.32043 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_091169996.1.32043
Domain Number 1 Region: 528-937
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.2e-35
Family alpha-mannosidase, C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 119-302
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000319
Family alpha-mannosidase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_091169996.1.32043
Sequence length 960
Comment glycoside hydrolase [Mucilaginibacter gossypii]; AA=GCF_900100945.1; RF=na; TAX=551996; STAX=551996; NAME=Mucilaginibacter gossypii; strain=Gh-67; AL=Scaffold; RT=Major
Sequence
MNKIFSILSAFIFICTSAMAQTGGKHFNGITLQPTIAYINYQGQSRRMARLLFHEGKSFA
ATEVTVSFNGITDHVIIPASKEGTDVFELPLPGSPITSAAQVTVTLNSGGQTYMARCIVE
PARNNWTMYILPHSHVDIGYTNTQAKVLKLHMDNIDEAIDLAKKTANYPVEAHYKWTTEA
IWVVDNYLKAAGEAKKERFWDAVKKGWINLDGAYGNINTSMTDSYQLMQMFAKSQKLAKA
NEVEIHTMFQGDVPGASWGLAAQSEQTGIKYFLSGPNASDRIGNLAKWQDKPFYWISPSG
KQKLLFWQCQPYSIGYALKGTRIPNFFTIDDPKPFYTGHPSDNFLNPHLFQYLGGLEQNN
FPYNMSLLTWAMSDNAPIDPELPDAVKSWNEHFASPKLVITSVKQFFQDFEKQYQDKIPS
FTGDYTEYWTDGVSSAAKETAISRQTSDKLKQASALWAIRNKPGYPVNDFDDTWKNLLLY
NEHTWGAYNSVDDPEDAKVKSEWTIKKGYALSAQKQTDSLSNLILAIKTAAANKVDVYNT
LSWPRTDVVYVPAGLSKAGDLVKDATGNAIPSQRLSSGELAFVATGVPAFGKKTYTINRG
KAFAKSKAVISLNGLANGIYTVTIDSKTGDISKLVKIEGGKKQVLVDSTGFNKYIYMPGD
SLQRQQTSTDAIISIKEDGPLVVSLLVTSKAPGAYGLTREIRLVNGLDKIELINTIDKES
IRSKESVHFAFPFSVPGAQVRYSIPWGSAAAEADQLPNANKNWFTMQRWVDVSNSAFGIT
WSSPDAPLFEIGKITTADLLGGLHHAPQWLTFTAQSPKIYSWVMNNLWHTNFRAEQEKGP
ATFRYIFRSHALGYDSFDANRFGLNNHQPLVVSASDNQDDELFFNIGGKQIYVESLKPAD
DGNGVIAQIVSTGDSEVSITPKAKTTIKVWKSNLTEEKVAALDNNFKISAKGIITVRIEK
Download sequence
Identical sequences A0A1G8BXS8
WP_091169996.1.32043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]